KEGG   Homo sapiens (human): 240Help
Entry
240               CDS       T01001                                 

Gene name
ALOX5, 5-LO, 5-LOX, 5LPG, LOG5
Definition
(RefSeq) arachidonate 5-lipoxygenase
  KO
K00461  arachidonate 5-lipoxygenase [EC:1.13.11.34]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04664  Fc epsilon RI signaling pathway
hsa04726  Serotonergic synapse
hsa04913  Ovarian steroidogenesis
hsa05145  Toxoplasmosis
Drug target
Atreleuton: D03010
Benoxaprofen: D03080
Benzydamine (except lozenges) (DG00014): D01410 D07516 D07517
Darbufelone mesylate: D03652
Docebenone: D03882
Enazadrem phosphate: D03990
Fenleuton: D04151
Linazolast: D09850
Lonapalene: D04770
Oxatomide: D01773
Piriprost (DG02899): D05498 D05499
Setileuton: D09667
Tebufelone: D06017
Tepoxalin: D06075
Zileuton: D00414
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    240 (ALOX5)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    240 (ALOX5)
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    240 (ALOX5)
  09156 Nervous system
   04726 Serotonergic synapse
    240 (ALOX5)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    240 (ALOX5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.34  arachidonate 5-lipoxygenase
     240 (ALOX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipoxygenase PLAT
Motif
Other DBs
NCBI-GeneID: 240
NCBI-ProteinID: NP_000689
OMIM: 152390
HGNC: 435
Ensembl: ENSG00000012779
Vega: OTTHUMG00000018081
Pharos: P09917(Tclin)
UniProt: P09917
Structure
PDB: 

Position
10q11.21
AA seq 674 aa AA seqDB search
MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE
ELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLA
RDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL
NYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNG
CNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP
CTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDF
HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECG
LFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWE
AIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYL
TVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW
HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPY
YYLSPDRIPNSVAI
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgccctcctacacggtcaccgtggccactggcagccagtggttcgccggcactgacgac
tacatctacctcagcctcgtgggctcggcgggctgcagcgagaagcacctgctggacaag
cccttctacaacgacttcgagcgtggcgcggtggattcatacgacgtgactgtggacgag
gaactgggcgagatccagctggtcagaatcgagaagcgcaagtactggctgaatgacgac
tggtacctgaagtacatcacgctgaagacgccccacggggactacatcgagttcccctgc
taccgctggatcaccggcgatgtcgaggttgtcctgagggatggacgcgcaaagttggcc
cgagatgaccaaattcacattctcaagcaacaccgacgtaaagaactggaaacacggcaa
aaacaatatcgatggatggagtggaaccctggcttccccttgagcatcgatgccaaatgc
cacaaggatttaccccgtgatatccagtttgatagtgaaaaaggagtggactttgttctg
aattactccaaagcgatggagaacctgttcatcaaccgcttcatgcacatgttccagtct
tcttggaatgacttcgccgactttgagaaaatctttgtcaagatcagcaacactatttct
gagcgggtcatgaatcactggcaggaagacctgatgtttggctaccagttcctgaatggc
tgcaaccctgtgttgatccggcgctgcacagagctgcccgagaagctcccggtgaccacg
gagatggtagagtgcagcctggagcggcagctcagcttggagcaggaggtccagcaaggg
aacattttcatcgtggactttgagctgctggatggcatcgatgccaacaaaacagacccc
tgcacactccagttcctggccgctcccatctgcttgctgtataagaacctggccaacaag
attgtccccattgccatccagctcaaccaaatcccgggagatgagaaccctattttcctc
ccttcggatgcaaaatacgactggcttttggccaaaatctgggtgcgttccagtgacttc
cacgtccaccagaccatcacccaccttctgcgaacacatctggtgtctgaggtttttggc
attgcaatgtaccgccagctgcctgctgtgcaccccattttcaagctgctggtggcacac
gtgagattcaccattgcaatcaacaccaaggcccgtgagcagctcatctgcgagtgtggc
ctctttgacaaggccaacgccacagggggcggtgggcacgtgcagatggtgcagagggcc
atgaaggacctgacctatgcctccctgtgctttcccgaggccatcaaggcccggggcatg
gagagcaaagaagacatcccctactacttctaccgggacgacgggctcctggtgtgggaa
gccatcaggacgttcacggccgaggtggtagacatctactacgagggcgaccaggtggtg
gaggaggacccggagctgcaggacttcgtgaacgatgtctacgtgtacggcatgcggggc
cgcaagtcctcaggcttccccaagtcggtcaagagccgggagcagctgtcggagtacctg
accgtggtgatcttcaccgcctccgcccagcacgccgcggtcaacttcggccagtacgac
tggtgctcctggatccccaatgcgcccccaaccatgcgagccccgccaccgactgccaag
ggcgtggtgaccattgagcagatcgtggacacgctgcccgaccgcggccgctcctgctgg
catctgggtgcagtgtgggcgctgagccagttccaggaaaacgagctgttcctgggcatg
tacccagaagagcattttatcgagaagcctgtgaaggaagccatggcccgattccgcaag
aacctcgaggccattgtcagcgtgattgctgagcgcaacaagaagaagcagctgccatat
tactacttgtccccagaccggattccgaacagtgtggccatctga

DBGET integrated database retrieval system