KEGG   Homo sapiens (human): 241Help
Entry
241               CDS       T01001                                 

Gene name
ALOX5AP, FLAP
Definition
(RefSeq) arachidonate 5-lipoxygenase activating protein
  KO
K20735  arachidonate 5-lipoxygenase-activating protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04664  Fc epsilon RI signaling pathway
Drug target
Fiboflapon (DG02039): D10069 D10122
Quiflapon sodium: D05671
Veliflapon: D06664
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    241 (ALOX5AP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG DUF2628
Motif
Other DBs
NCBI-GeneID: 241
NCBI-ProteinID: NP_001620
OMIM: 603700
HGNC: 436
Ensembl: ENSG00000132965
Vega: OTTHUMG00000016677
Pharos: P20292(Tchem)
UniProt: P20292
Structure
PDB: 

Position
13q12.3
AA seq 161 aa AA seqDB search
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggatcaagaaactgtaggcaatgttgtcctgttggccatcgtcaccctcatcagcgtg
gtccagaatggattctttgcccataaagtggagcacgaaagcaggacccagaatgggagg
agcttccagaggaccggaacacttgcctttgagcgggtctacactgccaaccagaactgt
gtagatgcgtaccccactttcctcgctgtgctctggtctgcggggctactttgcagccaa
gttcctgctgcgtttgctggactgatgtacttgtttgtgaggcaaaagtactttgtcggt
tacctaggagagagaacgcagagcacccctggctacatatttgggaaacgcatcatactc
ttcctgttcctcatgtccgttgctggcatattcaactattacctcatcttctttttcgga
agtgactttgaaaactacataaagacgatctccaccaccatctcccctctacttctcatt
ccctaa

DBGET integrated database retrieval system