KEGG   Homo sapiens (human): 24138Help
Entry
24138             CDS       T01001                                 

Gene name
IFIT5, ISG58, P58, RI58
Definition
(RefSeq) interferon induced protein with tetratricopeptide repeats 5
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_14 TPR_8 TPR_12 TPR_19 TPR_11 TPR_17 TPR_7 TPR_15 TPR_10 TPR_16 TPR_MalT ANAPC3 PUL EST1_DNA_bind Sec16_C DUF2150
Motif
Other DBs
NCBI-GeneID: 24138
NCBI-ProteinID: NP_036552
OMIM: 616135
HGNC: 13328
Ensembl: ENSG00000152778
Vega: OTTHUMG00000018713
Pharos: Q13325(Tbio)
UniProt: Q13325
Structure
PDB: 

Position
10q23.31
AA seq 482 aa AA seqDB search
MSEIRKDTLKAILLELECHFTWNLLKEDIDLFEVEDTIGQQLEFLTTKSRLALYNLLAYV
KHLKGQNKDALECLEQAEEIIQQEHSDKEEVRSLVTWGNYAWVYYHMDQLEEAQKYTGKI
GNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKAKAAFEKALEVEPDNPEFNIGY
AITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAEAEGEKYIEE
ILDQISSQPYVLRYAAKFYRRKNSWNKALELLKKALEVTPTSSFLHHQMGLCYRAQMIQI
KKATHNRPKGKDKLKVDELISSAIFHFKAAMERDSMFAFAYTDLANMYAEGGQYSNAEDI
FRKALRLENITDDHKHQIHYHYGRFQEFHRKSENTAIHHYLEALKVKDRSPLRTKLTSAL
KKLSTKRLCHNALDVQSLSALGFVYKLEGEKRQAAEYYEKAQKIDPENAEFLTALCELRL
SI
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaattcgtaaggacaccttgaaggccattctgttggagttagaatgtcatttt
acatggaatttacttaaggaagacattgatctgtttgaggtagaagatacaattgggcaa
cagcttgaatttcttaccacaaaatctagacttgctctttataacctattggcctatgtg
aaacacctaaaaggccaaaataaagacgcccttgagtgcttggaacaagcagaagaaata
atccagcaagaacactcagacaaagaagaagtacgaagcctggtcacttggggaaactat
gcctgggtgtattatcacatggaccagcttgaagaagctcagaagtatacaggtaagata
gggaatgtctgtaagaaattgtccagtccttctaactacaagttggagtgtcctgagact
gactgtgagaaaggctgggcactcttgaaatttggaggaaagtattatcaaaaggctaaa
gcggcttttgagaaggctctggaagtggagcctgacaatccagaatttaacatcggctat
gctatcacagtgtatcggctggatgattctgatagagaagggtctgtaaagagcttttct
ctggggcctttgagaaaggctgttaccctgaacccagataacagctatattaaggttttt
ctggcactgaagcttcaagatgtacatgcagaagctgaaggggaaaagtatattgaagaa
atcctggaccaaatatcatcccagccttacgtccttcgttatgcagccaagttctatagg
agaaaaaattcctggaacaaagctctcgaacttttaaaaaaggccttggaggtgacacca
acttcttctttcctgcatcaccagatgggactttgctacagggcacaaatgatccaaatc
aagaaggccacacacaacagacctaaaggaaaggataaactaaaggttgatgagctgatt
tcatctgctatatttcatttcaaagcagccatggaacgagactctatgtttgcatttgcc
tacacagacctggccaacatgtacgctgaaggaggccagtatagcaatgctgaggacatt
ttccggaaagctcttcgtctggagaacataaccgatgatcacaaacatcagatccattac
cactatggccgctttcaggaatttcaccgtaaatcagaaaatactgccatccatcattat
ttagaagccttaaaggtcaaagacagatcaccccttcgcaccaaactgacaagtgctctg
aagaaattgtctaccaagagactttgtcacaatgctttagatgtgcagagtttaagtgcc
ctagggtttgtttacaagctggaaggagaaaagaggcaagctgctgagtactatgagaag
gcacaaaagatagatccagaaaatgcagaattcctgactgctctctgtgagctccgactt
tccatttaa

DBGET integrated database retrieval system