KEGG   Homo sapiens (human): 24139Help
Entry
24139             CDS       T01001                                 

Gene name
EML2, ELP70, EMAP-2, EMAP2
Definition
(RefSeq) EMAP like 2
  KO
K18595  echinoderm microtubule-associated protein-like 1/2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    24139 (EML2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EMAP
     24139 (EML2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HELP WD40 ANAPC4_WD40 Ge1_WD40 Nucleoporin_N CPSF_A DPPIV_N
Motif
Other DBs
NCBI-GeneID: 24139
NCBI-ProteinID: NP_036287
OMIM: 617494
HGNC: 18035
Ensembl: ENSG00000125746
Vega: OTTHUMG00000182127
Pharos: O95834(Tbio)
UniProt: O95834
Position
19q13.32
AA seq 649 aa AA seqDB search
MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWV
YGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTI
ATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVD
ESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLS
KRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGL
CALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSI
LQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEDP
ARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSPDGAYLAVGSH
DNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSSCFVTNSGDYEILYWDPATCKQ
ITSADAVRNMEWATATCVLGFGVFGIWSEGADGTDINAVARSHDGKLLASADDFGKVHLF
SYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQWRVV
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctttggagctggcaaaaccaaagaagttatcttcagtgtggaggatggctcc
gtgaaaatgttcctgaggggccgccctgtgcccatgatgatcccagacgagctggcaccc
acctacagcctggacacacgctcggagctgccttcttgccggctcaagctggagtgggtc
tatggctaccgtggccgagactgccgggccaacctttatttgctgcccaccggggagata
gtgtactttgtggcctccgtagccgtgctatacagcgtggaggagcagaggcagcgacac
tacctgggacacaacgatgacatcaaatgcttggccatccacccagatatggtcaccatc
gccacgggacaggtggcgggaaccactaaggaagggaagccgctgccgccccacgtgcgc
atctgggactcagtttccctctccaccttacacgtgctgggcttgggggtgtttgacaga
gccgtgtgctgtgtgggcttctccaaatctaatggaggcaacctgctgtgtgcagtggat
gaatccaatgatcacatgctctcggtgtgggactgggccaaggagaccaaggtggtggat
gtcaagtgctccaatgaggctgtattggtggccaccttccaccccacggaccccactgtg
cttatcacctgcgggaaatctcacatctacttctggaccttggaggggggcagcttgagc
aagcggcaaggcctctttgagaaacatgagaaaccgaagtatgtgctgtgtgtgaccttt
ttggaaggtggcgacgtggtcacgggggactctggggggaacctctatgtttggggcaaa
ggtgggaaccgtatcacacaggcggtgctgggcgcccacgacggcggcgtgtttgggctc
tgcgccctgcgggacgggacgctggtgtctggagggggccgtgatcggcgggtggtcctc
tggggttctgactacagcaagctgcaggaagtggaggtccctgaggactttggccctgtg
cgcaccgtggcagagggccacggagacacactgtacgtggggaccacccgcaattccatc
ctgcagggctccgtgcacacaggcttctcactgctggtccagggccatgtggaagagctg
tggggcctggccacacaccccagtcgggcccagtttgtgacctgcgggcaggataagctg
gtgcatctatggagctcagattcccaccagcccctgtggagcaggatcatcgaggaccct
gcccgctcagccggcttccaccccagtggctctgtcctggctgtgggtacagtgactggc
agatggctgctgctggacacggagacccatgacctggtggctatccacacagacggcaat
gaacagatctcagtggtcagcttctccccagacggggcgtacctggccgtgggctcccac
gacaacttggtgtacgtgtacacggtggaccagggcggccgcaaggtcagccgcctgggc
aagtgctcgggccattccagttttatcacccacctggattgggcccaggacagcagctgc
tttgtcaccaactccggggactatgagattctgtactgggacccggctacctgtaagcag
atcaccagtgcggatgctgtgaggaacatggaatgggccacagctacttgtgtcctaggg
tttggggtgtttgggatctggtctgagggggcggacggcactgatatcaacgctgtggcc
cgctctcatgatgggaagttgctggcttcagctgatgactttggcaaagttcacctgttt
agctacccctgctgtcagcctcgagccctcagccacaagtacggtggacacagcagccat
gtgacaaatgtggccttcttgtgggatgacagcatggccctgaccacagggggcaaggac
accagtgtgctacagtggcgggtggtctga

DBGET integrated database retrieval system