KEGG   Homo sapiens (human): 24142Help
Entry
24142             CDS       T01001                                 

Gene name
NAA80, FUS-2, FUS2, HsNAAA80, NAT6
Definition
(RefSeq) N-alpha-acetyltransferase 80, NatH catalytic subunit
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_CG Acetyltransf_4
Motif
Other DBs
NCBI-GeneID: 24142
NCBI-ProteinID: NP_001186945
OMIM: 607073
HGNC: 30252
Ensembl: ENSG00000243477
Vega: OTTHUMG00000156939
Pharos: Q93015(Tbio)
UniProt: Q93015 A0A024R2Z7 Q6IAP1
Position
3p21.31
AA seq 286 aa AA seqDB search
MELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQPEETPAPSLAEL
TLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVV
VGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQV
HFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPP
LPPPPPLPECLTISPPVPSGPPSKSLLETQYQNVRGRPIFWMEKDI
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggagctgatcctgagtaccagcccagctgagctgactctggatcctgcgtgccagcca
aagctgcccctggattccacatgccaaccagagatgaccttcaatcctggtccaactgag
cttaccctggatcctgaacaccagccagaggagaccccagctcctagcctggctgagttg
accctggagcctgtgcaccgccgacccgagctcctggatgcttgtgctgacctcatcaat
gatcagtggccccgcagccgcacctcccgcctgcactccctgggccagtcctcagatgcc
ttccccctctgcctgatgctgctaagcccccaccccacacttgaagcagcacccgttgtg
gtgggccatgcccgcctgtcacgggtgctgaaccagccccagagcctcttagtggagaca
gtggtggtggcccgggccctgaggggccgtggctttggccgccgcctcatggagggcctg
gaggtctttgctcgggcccggggcttccgcaagctgcatctcaccacccatgaccaggtg
cacttctatacccacctgggctaccagctgggtgagcctgtgcagggcctggtcttcacc
agcagacggctgcctgccaccctgcttaatgccttccccacagccccctctccccggcca
cccaggaaggccccaaacctgactgcccaagctgccccaaggggtcccaagggacctcca
ttgccaccaccccctcccctacctgagtgcctgaccatctcacccccagttccatcaggg
cccccttcaaaaagcctgctggagacacaatatcaaaatgtgagggggcgccccatattc
tggatggaaaaagacatctga

DBGET integrated database retrieval system