KEGG   Homo sapiens (human): 24145
Entry
24145             CDS       T01001                                 

Gene name
PANX1, MRS1, OOMD7, PX1, UNQ2529
Definition
(RefSeq) pannexin 1
  KO
K03443  pannexin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Disease
H01897  Oocyte maturation defect
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    24145 (PANX1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    24145 (PANX1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   24145 (PANX1)
SSDB
Motif
Pfam: Innexin
Other DBs
NCBI-GeneID: 24145
NCBI-ProteinID: NP_056183
OMIM: 608420
HGNC: 8599
Ensembl: ENSG00000110218
Vega: OTTHUMG00000167757
Pharos: Q96RD7(Tbio)
UniProt: Q96RD7 A0A024R397
Position
11q21
AA seq 426 aa
MAIAQLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISI
GTQISCFSPSSFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFFPYILLLFAILL
YLPPLFWRFAAAPHICSDLKFIMEELDKVYNRAIKAAKSARDLDMRDGACSVPGVTENLG
QSLWEVSESHFKYPIVEQYLKTKKNSNNLIIKYISCRLLTLIIILLACIYLGYYFSLSSL
SDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVINLVVYVLLAPVVVYTLFVPFR
QKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQG
IDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQR
LLDSSC
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggccatcgctcaactggccacggagtacgtgttctcggatttcttgctgaaggagccc
acggagcccaagttcaaggggctgcgactggagctggctgtggacaagatggtcacgtgc
attgcggtggggctgcccctgctgctcatctcgctggccttcgcgcaggagatctcgatt
ggtacacagataagctgtttctctccaagttctttctcctggcgtcaggctgcctttgtg
gattcatattgctgggcggctgttcagcagaagaactcactgcagagcgagtctggaaac
ctcccactgtggctgcataagtttttcccctacatcctgctgctctttgcgatcctcctg
tacctgcccccgctgttctggcgtttcgcagctgctcctcatatttgctcagacttgaag
tttatcatggaagaacttgacaaagtttacaaccgtgcaattaaggctgcaaagagtgcg
cgtgaccttgacatgagagatggagcctgctcagttccaggtgttaccgagaacttaggg
caaagtttgtgggaggtatctgaaagccacttcaagtacccaattgtggagcagtacttg
aagacaaagaaaaattctaataatttaatcatcaagtacattagctgccgcctgctgaca
ctcatcattatactgttagcgtgtatctacctgggctattacttcagcctctcctcactc
tcagacgagtttgtgtgcagcatcaaatcagggatcctgagaaacgacagcaccgtgccc
gatcagtttcagtgcaaactcattgccgtgggcatcttccagttgctcagtgtcattaac
cttgtggtttatgtcctgctggctcccgtggttgtctacacgctgtttgttccattccga
cagaagacagatgttctcaaagtgtacgaaatcctccccacttttgatgttctgcatttc
aaatctgaagggtacaacgatttgagcctctacaatctcttcttggaggaaaatataagt
gaggtcaagtcatacaagtgtcttaaggtactggagaatattaagagcagtggtcagggg
atcgacccaatgctactcctgacaaaccttggcatgatcaagatggatgttgttgatggc
aaaactcccatgtctgcagagatgagagaggagcaggggaaccagacggcagagctccaa
ggtatgaacatagacagtgaaactaaagcaaataatggagagaagaatgcccgacagaga
cttctggattcttcttgctga

DBGET integrated database retrieval system