KEGG   Homo sapiens (human): 245711Help
Entry
245711            CDS       T01001                                 

Gene name
SPDYA, RINGO3, RINGOA, SPDY1, SPY1
Definition
(RefSeq) speedy/RINGO cell cycle regulator family member A
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    245711 (SPDYA)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    245711 (SPDYA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spy1
Motif
Other DBs
NCBI-GeneID: 245711
NCBI-ProteinID: NP_001136106
OMIM: 614029
HGNC: 30613
Ensembl: ENSG00000163806
Vega: OTTHUMG00000074041
Pharos: Q5MJ70(Tbio)
UniProt: Q5MJ70 A0A384MTT5
Structure
PDB: 

Position
2p23.2
AA seq 313 aa AA seqDB search
MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPK
GPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTR
INFFIALYLANTVEEDEEETKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRR
CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRL
GLSSSSSLSSHTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLK
KDKSMEWFTGSEE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaggcacaatcagatgtgttgtgagacaccacctactgtcactgtttatgtaaaatca
gggtcaaatagatcacatcagcctaaaaagcccattactctgaagcgtcctatttgtaaa
gataattggcaagcatttgaaaaaaatacacataataacaacaaatctaaacgccccaaa
ggaccttgtctggttatacagcgtcaggatatgactgctttctttaaattatttgatgac
gatttaattcaagatttcttgtggatggactgctgctgtaaaattgcagacaagtatctt
ttggctatgacctttgtttatttcaagagggctaaatttactataagtgagcataccagg
ataaatttctttattgctctgtatctggctaatacagttgaagaagatgaagaagaaacc
aagtacgaaatttttccatgggctttagggaaaaactggagaaaattgttccctaatttc
ttaaagttaagggaccagctctgggatagaattgactatagggctattgtaagcaggcga
tgttgtgaggaggttatggccattgcaccaacccattatatctggcaaagagaacgttct
gttcatcacagtggagctgtcagaaactacaacagagatgaagttcagctgccccgggga
cctagtgccacaccagtagattgttcactctgtggtaaaaaaagaagatatgttagactg
ggattgtcttcatcatcatctttatccagtcatacagcaggggtgacagaaaaacattct
caggactcatacaactcactgtcaatggacataataggtgatccttctcaagcttatact
ggttctgaagtagtcaatgaccatcaatcaaataaaggaaagaaaactaatttcttgaag
aaagacaaatctatggagtggtttacaggaagtgaagaatga

DBGET integrated database retrieval system