KEGG   Homo sapiens (human): 245908Help
Entry
245908            CDS       T01001                                 

Gene name
DEFB105A, BD-5, DEFB-5, DEFB105
Definition
(RefSeq) defensin beta 105A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Defensin_beta_2
Motif
Other DBs
NCBI-GeneID: 245908
NCBI-ProteinID: NP_689463
HGNC: 18087
Ensembl: ENSG00000186562
Vega: OTTHUMG00000150011
UniProt: Q8NG35 A0A0K0K1I4
Position
8p23.1
AA seq 78 aa AA seqDB search
MALIRKTFYFLFAMFFILVQLPSGCQAGLDFSQPFPSGEFAVCESCKLGRGKCRKECLEN
EKPDGNCRLNFLCCRQRI
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atggccctgatcaggaagacattttattttctatttgctatgttcttcattttggttcaa
ctgccatcagggtgccaggcaggacttgatttttcccaaccatttccatcaggtgagttt
gctgtctgtgagtcgtgcaagcttggtcggggaaaatgcaggaaggagtgcttggagaat
gagaagcccgatggaaattgcaggctgaactttctctgctgcagacagaggatctga

DBGET integrated database retrieval system