KEGG   Homo sapiens (human): 245910
Entry
245910            CDS       T01001                                 

Gene name
DEFB107A, BD-7, DEFB-7, DEFB107
Definition
(RefSeq) defensin beta 107A
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Defensin_beta_2 Defensin_beta
Other DBs
NCBI-GeneID: 245910
NCBI-ProteinID: NP_001032757
HGNC: 18086
Ensembl: ENSG00000186572
Vega: OTTHUMG00000150013
UniProt: Q8IZN7
Position
8p23.1
AA seq 70 aa
MPGAMKIFVFILAALILLAQIFQARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELA
PFCCKNRKKH
NT seq 213 nt   +upstreamnt  +downstreamnt
atgcctggagccatgaaaatatttgtctttattttggctgctctcattcttcttgctcaa
attttccaagccaggacagcaattcatagagcactaattagtaagagaatggaaggtcac
tgtgaagccgaatgtcttacctttgaagtaaagattgggggctgtagagctgaattagca
ccattttgctgcaaaaacagaaagaaacattaa

DBGET integrated database retrieval system