KEGG   Homo sapiens (human): 245913Help
Entry
245913            CDS       T01001                                 

Gene name
DEFB110, DEFB-10, DEFB-11, DEFB111
Definition
(RefSeq) defensin beta 110
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Defensin_beta_2 Defensin_beta
Motif
Other DBs
NCBI-GeneID: 245913
NCBI-ProteinID: NP_001032586
HGNC: 18091
Ensembl: ENSG00000203970
Vega: OTTHUMG00000160208
Pharos: Q30KQ9(Tdark)
UniProt: Q30KQ9
Position
6p12.3
AA seq 67 aa AA seqDB search
MKIQLFFFILHFWVTILPAKKKYPEYGSLDLRRECRIGNGQCKNQCHENEIRIAYCIRPG
THCCLQQ
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcaactttttttctttattctgcacttttgggtcacaattttaccagccaaa
aagaaatatcctgagtatggtagcttggacttgaggagagagtgcagaataggtaatggt
caatgtaaaaatcagtgtcatgaaaatgaaattaggattgcttactgcataagacctgga
actcattgctgcttgcagcagtaa

DBGET integrated database retrieval system