KEGG   Homo sapiens (human): 245930
Entry
245930            CDS       T01001                                 
Symbol
DEFB116, DEFB-16
Name
(RefSeq) defensin beta 116
  KO
K25606  defensin, beta
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    245930 (DEFB116)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   245930 (DEFB116)
SSDB
Motif
Pfam: Defensin_beta_2
Other DBs
NCBI-GeneID: 245930
NCBI-ProteinID: NP_001032820
HGNC: 18097
Ensembl: ENSG00000215545
Pharos: Q30KQ4(Tdark)
UniProt: Q30KQ4
Position
20:complement(31303212..31308585)
AA seq 102 aa
MSVMKPCLMTIAILMILAQKTPGGLFRSHNGKSREPWNPCELYQGMCRNACREYEIQYLT
CPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSYSHI
NT seq 309 nt   +upstreamnt  +downstreamnt
atgtcagtcatgaagccctgtttaatgaccattgccatccttatgatcctggctcaaaag
actccaggtggcctgttcagatcccacaatggcaagagccgagagccttggaatccatgt
gagctttaccaaggcatgtgcagaaacgcctgcagagaatatgaaatccaatacttaacc
tgcccaaatgatcaaaagtgctgcctgaaactttctgtgaaaataaccagttctaaaaat
gtgaaggaggattacgactctaactccaacttgtcagttacaaacagttcaagctactct
cacatttga

DBGET integrated database retrieval system