KEGG   Homo sapiens (human): 245930
Entry
245930            CDS       T01001                                 

Gene name
DEFB116, DEFB-16
Definition
(RefSeq) defensin beta 116
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Defensin_beta_2
Other DBs
NCBI-GeneID: 245930
NCBI-ProteinID: NP_001032820
HGNC: 18097
Ensembl: ENSG00000215545
Vega: OTTHUMG00000159285
Pharos: Q30KQ4(Tdark)
UniProt: Q30KQ4
Position
20q11.21
AA seq 102 aa
MSVMKPCLMTIAILMILAQKTPGGLFRSHNGKSREPWNPCELYQGMCRNACREYEIQYLT
CPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSYSHI
NT seq 309 nt   +upstreamnt  +downstreamnt
atgtcagtcatgaagccctgtttaatgaccattgccatccttatgatcctggctcaaaag
actccaggtggcctgttcagatcccacaatggcaagagccgagagccttggaatccatgt
gagctttaccaaggcatgtgcagaaacgcctgcagagaatatgaaatccaatacttaacc
tgcccaaatgatcaaaagtgctgcctgaaactttctgtgaaaataaccagttctaaaaat
gtgaaggaggattacgactctaactccaacttgtcagttacaaacagttcaagctactct
cacatttga

DBGET integrated database retrieval system