KEGG   Homo sapiens (human): 245932Help
Entry
245932            CDS       T01001                                 

Gene name
DEFB119, DEFB-19, DEFB-20, DEFB120, DEFB20, ESC42-RELA, ESC42-RELB
Definition
(RefSeq) defensin beta 119
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Defensin_beta_2 Defensin_big
Motif
Other DBs
NCBI-GeneID: 245932
NCBI-ProteinID: NP_695021
OMIM: 615997
HGNC: 18099
Ensembl: ENSG00000180483
Vega: OTTHUMG00000032172
Pharos: Q8N690(Tdark)
UniProt: Q8N690
Position
20q11.21
AA seq 84 aa AA seqDB search
MKLLYLFLAILLAIEEPVISGKRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSY
MRISISGKEENTDWSYEKQWPRLP
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttctttacctgtttcttgccatccttctggccatagaagaaccagtgatatca
ggcaaacgccacatccttcgatgcatgggtaacagtggaatttgtagggcctcttgcaaa
aagaacgaacagccctacctctattgcagaaattgtcagtcctgctgcctccagtcctac
atgaggataagcatttctggcaaagaggaaaataccgactggtcttatgagaagcagtgg
ccaagactaccttga

DBGET integrated database retrieval system