KEGG   Homo sapiens (human): 245937
Entry
245937            CDS       T01001                                 

Gene name
DEFB124, DEFB-24
Definition
(RefSeq) defensin beta 124
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Defensin_beta_2 zf-RVT
Other DBs
NCBI-GeneID: 245937
NCBI-ProteinID: NP_001032589
HGNC: 18104
Ensembl: ENSG00000180383
Vega: OTTHUMG00000159287
Pharos: Q8NES8(Tdark)
UniProt: Q8NES8
Position
20q11.21
AA seq 71 aa
MTQLLLFLVALLVLGHVPSGRSEFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYAL
KPPPVPKHEYE
NT seq 216 nt   +upstreamnt  +downstreamnt
atgacacagctgcttctgttccttgtggctctcctggttctgggtcatgtgccatcaggg
agaagtgaattcaaacggtgctggaagggtcaaggggcctgccaaacttactgcacaagg
caagaaacttacatgcacctgtgcccggatgcgtccctgtgctgtctctcctatgcattg
aaacctccaccggtccccaagcatgaatatgagtag

DBGET integrated database retrieval system