KEGG   Homo sapiens (human): 245939
Entry
245939            CDS       T01001                                 

Gene name
DEFB128, DEFB-28, DEFB28, hBD-28
Definition
(RefSeq) defensin beta 128
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Defensin_beta_2
Other DBs
NCBI-GeneID: 245939
NCBI-ProteinID: NP_001032821
HGNC: 18106
Ensembl: ENSG00000185982
Vega: OTTHUMG00000043057
Pharos: Q7Z7B8(Tdark)
UniProt: Q7Z7B8
Position
20p13
AA seq 93 aa
MKLFLVLIILLFEVLTDGARLKKCFNKVTGYCRKKCKVGERYEIGCLSGKLCCANDEEEK
KHVSFKKPHQHSGEKLSVLQDYIILPTITIFTV
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagctgtttctggttctcattattctgctgtttgaggtactcacagacggggcaaga
ctcaaaaaatgcttcaataaagtaacaggctattgcaggaagaaatgcaaggtaggagaa
agatatgaaataggatgtctaagtgggaaattatgttgtgctaatgatgaagaagagaaa
aaacatgtgtcatttaagaagccacatcaacattctggtgagaagctgagtgtgctgcag
gattacatcatcttacccaccatcaccattttcacagtctaa

DBGET integrated database retrieval system