KEGG   Homo sapiens (human): 245940
Entry
245940            CDS       T01001                                 

Gene name
DEFB130A, DEFB-30, DEFB130, DEFB130L, DEFB30
Definition
(RefSeq) defensin beta 130A
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Defensin_beta
Other DBs
NCBI-GeneID: 245940
NCBI-ProteinID: NP_001032893
HGNC: 18107
Ensembl: ENSG00000232948
Vega: OTTHUMG00000158742
Pharos: Q30KQ2(Tdark)
UniProt: P0DP74 P0DP73
Position
8p23.1
AA seq 79 aa
MKLHSLISVLLLFVTLIPKGKTGVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCC
RRWWILEPYPTPVPKGKSP
NT seq 240 nt   +upstreamnt  +downstreamnt
atgaaactccattcccttatttctgttctcctcctctttgtgactttaataccaaaagga
aagactggcgttattccaggacaaaaacagtgtattgctttgaaaggggtgtgcagagac
aaactatgcagcacactagatgataccattggtatatgtaatgaaggaaaaaaatgttgt
agaaggtggtggatacttgagccctatccaactccggttcccaaaggaaaatctccttag

DBGET integrated database retrieval system