KEGG   Homo sapiens (human): 245940
Entry
245940            CDS       T01001                                 
Symbol
DEFB130A, DEFB-30, DEFB130, DEFB130L, DEFB30
Name
(RefSeq) defensin beta 130A
  KO
K25606  defensin, beta
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    245940 (DEFB130A)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   245940 (DEFB130A)
SSDB
Motif
Pfam: Defensin_beta
Other DBs
NCBI-GeneID: 245940
NCBI-ProteinID: NP_001032893
HGNC: 18107
Ensembl: ENSG00000232948
Pharos: Q30KQ2(Tdark)
UniProt: P0DP74 P0DP73
Position
8:complement(12310962..12318316)
AA seq 79 aa
MKLHSLISVLLLFVTLIPKGKTGVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCC
RRWWILEPYPTPVPKGKSP
NT seq 240 nt   +upstreamnt  +downstreamnt
atgaaactccattcccttatttctgttctcctcctctttgtgactttaataccaaaagga
aagactggcgttattccaggacaaaaacagtgtattgctttgaaaggggtgtgcagagac
aaactatgcagcacactagatgataccattggtatatgtaatgaaggaaaaaaatgttgt
agaaggtggtggatacttgagccctatccaactccggttcccaaaggaaaatctccttag

DBGET integrated database retrieval system