KEGG   Homo sapiens (human): 245972Help
Entry
245972            CDS       T01001                                 

Gene name
ATP6V0D2, ATP6D2, VMA6
Definition
(RefSeq) ATPase H+ transporting V0 subunit d2
  KO
K02146  V-type H+-transporting ATPase subunit d
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04142  Lysosome
hsa04145  Phagosome
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05152  Tuberculosis
hsa05203  Viral carcinogenesis
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    245972 (ATP6V0D2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    245972 (ATP6V0D2)
   04142 Lysosome
    245972 (ATP6V0D2)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    245972 (ATP6V0D2)
  Nervous system
   04721 Synaptic vesicle cycle
    245972 (ATP6V0D2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    245972 (ATP6V0D2)
  Immune diseases
   05323 Rheumatoid arthritis
    245972 (ATP6V0D2)
  Infectious diseases
   05110 Vibrio cholerae infection
    245972 (ATP6V0D2)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    245972 (ATP6V0D2)
   05152 Tuberculosis
    245972 (ATP6V0D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: vATP-synt_AC39
Motif
Other DBs
NCBI-GeneID: 245972
NCBI-ProteinID: NP_689778
HGNC: 18266
Ensembl: ENSG00000147614
Vega: OTTHUMG00000163637
Pharos: Q8N8Y2(Tbio)
UniProt: Q8N8Y2 A0A024R991
Position
8q21.3
AA seq 350 aa AA seqDB search
MLEGAELYFNVDHGYLEGLVRGCKASLLTQQDYINLVQCETLEDLKIHLQTTDYGNFLAN
HTNPLTVSKIDTEMRKRLCGEFEYFRNHSLEPLSTFLTYMTCSYMIDNVILLMNGALQKK
SVKEILGKCHPLGRFTEMEAVNIAETPSDLFNAILIETPLAPFFQDCMSENALDELNIEL
LRNKLYKSYLEAFYKFCKNHGDVTAEVMCPILEFEADRRAFIITLNSFGTELSKEDRETL
YPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
NVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPIL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaaggtgcggagctgtacttcaacgtggaccatggctacctggagggcctggtt
cgaggatgcaaggccagcctcctgacccagcaagactatatcaacctggtccagtgtgag
accctagaagacctgaaaattcatctccagactactgattatggtaactttttggctaat
cacacaaatcctcttactgtttccaaaattgacactgagatgaggaaaagactatgtgga
gaatttgagtatttccggaatcattccctggagcccctcagcacatttctcacctatatg
acgtgcagttatatgatagacaatgtgattctgctgatgaatggtgcattgcagaaaaaa
tctgtgaaagaaattctggggaagtgccaccccttgggccgtttcacagaaatggaagct
gtcaacattgcagagacaccttcagatctctttaatgccattctgatcgaaacgccatta
gctccattcttccaagactgcatgtctgaaaatgctctagatgaactgaatattgaattg
ctacgcaataaactatacaagtcttaccttgaggcattctataaattctgtaagaatcat
ggtgatgtcacagcagaagttatgtgtcccattcttgagtttgaggccgacagacgtgct
tttatcatcactcttaactcctttggcactgaattgagcaaagaagaccgagagaccctc
tatccaaccttcggcaaactctatcctgaggggttgcggctgttggctcaagcagaagac
tttgaccagatgaagaacgtagcggatcattacggagtatacaaacctttatttgaagct
gtaggtggcagtgggggaaagacattggaggacgtgttttacgagcgtgaggtacaaatg
aatgtgctggcattcaacagacagttccactacggtgtgttttatgcatatgtaaagctg
aaggaacaggaaattagaaatattgtgtggatagcagaatgtatttcacagaggcatcga
actaaaatcaacagttacattccaattttataa

DBGET integrated database retrieval system