KEGG   Homo sapiens (human): 245972
Entry
245972            CDS       T01001                                 

Gene name
ATP6V0D2, ATP6D2, VMA6
Definition
(RefSeq) ATPase H+ transporting V0 subunit d2
  KO
K02146  V-type H+-transporting ATPase subunit d
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04142  Lysosome
hsa04145  Phagosome
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05152  Tuberculosis
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    245972 (ATP6V0D2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    245972 (ATP6V0D2)
   04142 Lysosome
    245972 (ATP6V0D2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    245972 (ATP6V0D2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    245972 (ATP6V0D2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    245972 (ATP6V0D2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    245972 (ATP6V0D2)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    245972 (ATP6V0D2)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    245972 (ATP6V0D2)
   05152 Tuberculosis
    245972 (ATP6V0D2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    245972 (ATP6V0D2)
SSDB
Motif
Pfam: vATP-synt_AC39
Other DBs
NCBI-GeneID: 245972
NCBI-ProteinID: NP_689778
OMIM: 618072
HGNC: 18266
Ensembl: ENSG00000147614
Vega: OTTHUMG00000163637
Pharos: Q8N8Y2(Tbio)
UniProt: Q8N8Y2 A0A024R991
Position
8q21.3
AA seq 350 aa
MLEGAELYFNVDHGYLEGLVRGCKASLLTQQDYINLVQCETLEDLKIHLQTTDYGNFLAN
HTNPLTVSKIDTEMRKRLCGEFEYFRNHSLEPLSTFLTYMTCSYMIDNVILLMNGALQKK
SVKEILGKCHPLGRFTEMEAVNIAETPSDLFNAILIETPLAPFFQDCMSENALDELNIEL
LRNKLYKSYLEAFYKFCKNHGDVTAEVMCPILEFEADRRAFIITLNSFGTELSKEDRETL
YPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
NVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPIL
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgctcgaaggtgcggagctgtacttcaacgtggaccatggctacctggagggcctggtt
cgaggatgcaaggccagcctcctgacccagcaagactatatcaacctggtccagtgtgag
accctagaagacctgaaaattcatctccagactactgattatggtaactttttggctaat
cacacaaatcctcttactgtttccaaaattgacactgagatgaggaaaagactatgtgga
gaatttgagtatttccggaatcattccctggagcccctcagcacatttctcacctatatg
acgtgcagttatatgatagacaatgtgattctgctgatgaatggtgcattgcagaaaaaa
tctgtgaaagaaattctggggaagtgccaccccttgggccgtttcacagaaatggaagct
gtcaacattgcagagacaccttcagatctctttaatgccattctgatcgaaacgccatta
gctccattcttccaagactgcatgtctgaaaatgctctagatgaactgaatattgaattg
ctacgcaataaactatacaagtcttaccttgaggcattctataaattctgtaagaatcat
ggtgatgtcacagcagaagttatgtgtcccattcttgagtttgaggccgacagacgtgct
tttatcatcactcttaactcctttggcactgaattgagcaaagaagaccgagagaccctc
tatccaaccttcggcaaactctatcctgaggggttgcggctgttggctcaagcagaagac
tttgaccagatgaagaacgtagcggatcattacggagtatacaaacctttatttgaagct
gtaggtggcagtgggggaaagacattggaggacgtgttttacgagcgtgaggtacaaatg
aatgtgctggcattcaacagacagttccactacggtgtgttttatgcatatgtaaagctg
aaggaacaggaaattagaaatattgtgtggatagcagaatgtatttcacagaggcatcga
actaaaatcaacagttacattccaattttataa

DBGET integrated database retrieval system