KEGG   Homo sapiens (human): 245973
Entry
245973            CDS       T01001                                 

Gene name
ATP6V1C2, ATP6C2, VMA5
Definition
(RefSeq) ATPase H+ transporting V1 subunit C2
  KO
K02148  V-type H+-transporting ATPase subunit C
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04145  Phagosome
hsa04150  mTOR signaling pathway
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05165  Human papillomavirus infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    245973 (ATP6V1C2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    245973 (ATP6V1C2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    245973 (ATP6V1C2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    245973 (ATP6V1C2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    245973 (ATP6V1C2)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    245973 (ATP6V1C2)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    245973 (ATP6V1C2)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    245973 (ATP6V1C2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    245973 (ATP6V1C2)
SSDB
Motif
Pfam: V-ATPase_C DUF3584 MetW FliD_N Spc24 Cep57_MT_bd
Other DBs
NCBI-GeneID: 245973
NCBI-ProteinID: NP_001034451
OMIM: 618070
HGNC: 18264
Ensembl: ENSG00000143882
Vega: OTTHUMG00000090459
Pharos: Q8NEY4(Tbio)
UniProt: Q8NEY4
Position
2p25.1
AA seq 427 aa
MSEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKL
DTFAESLIRRMAQSVVEVMEDSKGKVQEHLLANGVDLTSFVTHFEWDMAKYPVKQPLVSV
VDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEY
LVTLLVIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKA
KENKFTVREFYYDEKEIEREREEMARLLSDKKQQYQTSCVALKKGSSTFPDHKVKVTPLG
NPDRPAAGQTDRERESEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVN
FQAVLLQPHKKSSTKRLREVLNSVFRHLDEVAATSILDASVEIPGLQLNNQDYFPYVYFH
IDLSLLD
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgtcggagttttggttaatttctgcccctggcgataaggaaaatttgcaagctctggag
aggatgaatactgtaacctccaagtccaacctgtcttataataccaaattcgctattcct
gacttcaaggtggggaccttggattccctggttggcctctctgatgagttggggaaactc
gacacctttgctgaaagcctcataaggagaatggctcagagcgtggtggaagtcatggag
gactcaaaggggaaggtccaggagcacctcctggcaaacggagttgacttaacatccttt
gtgacccactttgaatgggacatggccaaatatcctgtcaagcagccgctcgtgagtgtg
gtggacacaatagccaagcaactggcgcagatcgagatggacctgaagtcccgaacggcc
gcctacaacactctgaagacaaacctggagaacctggaaaagaaatccatggggaacctc
ttcacccggacactgagtgatattgtgagcaaagaggacttcgtgctggattctgaatat
ctcgtcacacttctggtcatcgtccccaaaccaaactactcacaatggcaaaaaacctac
gaatctctctcagacatggtggtccctcgatcaaccaaactcattactgaggacaaggaa
gggggccttttcactgtgactctgtttcgaaaagtgattgaagatttcaaaaccaaggcc
aaagaaaacaagttcactgttcgtgaattttactatgatgagaaggaaattgaaagggaa
agggaggagatggccagattgctgtctgataagaagcaacagtatcaaacttcctgtgtt
gctcttaaaaagggatcatccaccttcccggaccacaaggttaaggtaaccccgctaggt
aaccctgataggcctgctgcggggcagaccgacagagagagagagagtgagggcgagggt
gagggccccctgctgcgctggctcaaggtgaacttcagtgaagccttcattgcctggatc
cacatcaaggccctgagagtgtttgtggagtccgtgctcaggtatggactaccagtgaac
ttccaggcagtgctcctgcagccgcataagaagtcatccaccaagcgtttaagagaggtt
ctaaactctgtcttccgacatctggatgaagtagccgctacaagtatactggatgcatct
gtggagatcccgggactgcaactcaataaccaagactattttccttatgtctacttccat
attgaccttagtcttcttgactag

DBGET integrated database retrieval system