KEGG   Homo sapiens (human): 246100Help
Entry
246100            CDS       T01001                                 

Gene name
CTAG1A, CT6.1, ESO1, LAGE-2, LAGE2A, NY-ESO-1
Definition
(RefSeq) cancer/testis antigen 1A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Pcc1
Motif
Other DBs
NCBI-GeneID: 246100
NCBI-ProteinID: NP_640343
OMIM: 300657
HGNC: 24198
Ensembl: ENSG00000268651
Vega: OTTHUMG00000024238
Pharos: P78358(Tdark)
UniProt: P78358
Position
Xq28
AA seq 180 aa AA seqDB search
MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGA
PRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPG
VLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccgaaggccggggcacagggggttcgacgggcgatgctgatggcccaggaggc
cctggcattcctgatggcccagggggcaatgctggcggcccaggagaggcgggtgccacg
ggcggcagaggtccccggggcgcaggggcagcaagggcctcggggccgggaggaggcgcc
ccgcggggtccgcatggcggcgcggcttcagggctgaatggatgctgcagatgcggggcc
agggggccggagagccgcctgcttgagttctacctcgccatgcctttcgcgacacccatg
gaagcagagctggcccgcaggagcctggcccaggatgccccaccgcttcccgtgccaggg
gtgcttctgaaggagttcactgtgtccggcaacatactgactatccgactgactgctgca
gaccaccgccaactgcagctctccatcagctcctgtctccagcagctttccctgttgatg
tggatcacgcagtgctttctgcccgtgtttttggctcagcctccctcagggcagaggcgc
taa

DBGET integrated database retrieval system