KEGG   Homo sapiens (human): 246184
Entry
246184            CDS       T01001                                 

Gene name
CDC26, ANAPC12, APC12, C9orf17
Definition
(RefSeq) cell division cycle 26
  KO
K03359  anaphase-promoting complex subunit 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    246184 (CDC26)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    246184 (CDC26)
   04114 Oocyte meiosis
    246184 (CDC26)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    246184 (CDC26)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    246184 (CDC26)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    246184 (CDC26)
   03036 Chromosome and associated proteins [BR:hsa03036]
    246184 (CDC26)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     246184 (CDC26)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    246184 (CDC26)
SSDB
Motif
Pfam: ANAPC_CDC26
Other DBs
NCBI-GeneID: 246184
NCBI-ProteinID: NP_644815
OMIM: 614533
HGNC: 17839
Ensembl: ENSG00000176386
Vega: OTTHUMG00000020521
Pharos: Q8NHZ8(Tbio)
UniProt: Q8NHZ8 A0A024R832
Structure
PDB: 

Position
9q32
AA seq 85 aa
MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQM
INDRIGYKPQPKPNNRSSQFGSLEF
NT seq 258 nt   +upstreamnt  +downstreamnt
atgctgagacggaaaccaacacgcctagagctaaagcttgatgacattgaagagtttgag
aacattcgaaaggacctggagacccgtaagaaacagaaggaagatgtggaagttgtagga
ggcagtgatggagaaggagccattgggcttagcagtgatcccaagagccgggaacaaatg
atcaatgatcggattggttataaaccccaacccaagcccaataatcgttcatctcaattt
ggaagtcttgaattttag

DBGET integrated database retrieval system