KEGG   Homo sapiens (human): 246213Help
Entry
246213            CDS       T01001                                 

Gene name
SLC17A8, DFNA25, VGLUT3
Definition
(RefSeq) solute carrier family 17 member 8
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa05033  Nicotine addiction
Disease
H00604  Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    246213 (SLC17A8)
   04723 Retrograde endocannabinoid signaling
    246213 (SLC17A8)
   04721 Synaptic vesicle cycle
    246213 (SLC17A8)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    246213 (SLC17A8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    246213 (SLC17A8)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   246213 (SLC17A8)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    246213 (SLC17A8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 246213
NCBI-ProteinID: NP_647480
OMIM: 607557
HGNC: 20151
Ensembl: ENSG00000179520
Vega: OTTHUMG00000170358
Pharos: Q8NDX2(Tbio)
UniProt: Q8NDX2
Position
12q23.1
AA seq 589 aa AA seqDB search
MPFKAFDTFKEKILKPGKEGVKNAVGDSLGILQRKIDGTTEEEDNIELNEEGRPVQTSRP
SPPLCDCHCCGLPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEIQTA
QFNWDPETVGLIHGSFFWGYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARV
HYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGV
LVQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEEKTYIETSIGEGANVVSL
SKFSTPWKRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPH
MVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFL
VLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTRHKTREEW
QNVFLIAALVHYSGVIFYGVFASGEKQEWADPENLSEEKCGIIDQDELAEEIELNHESFA
SPKKKMSYGATSQNCEVQKKEWKGQRGATLDEEELTSYQNEERNFSTIS
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgccttttaaagcatttgataccttcaaagaaaaaattctgaaacctgggaaggaagga
gtgaagaacgccgtgggagattctttgggaattttacaaagaaaaatcgatgggacaact
gaggaagaagataacattgagctgaatgaagaaggaaggccggtgcagacgtccaggcca
agccccccactctgcgactgccactgctgcggcctccccaagcgttacatcattgctatc
atgagtgggctgggattctgcatttcctttgggatccggtgcaatcttggagttgccatt
gtggaaatggtcaacaatagcaccgtatatgttgatggaaaaccggaaattcagacagca
cagtttaactgggatccagaaacagtgggccttatccatggatcttttttctggggctat
attatgacacaaattccaggtggtttcatttcaaacaagtttgctgctaacagggtcttt
ggagctgccatcttcttaacatcgactctgaacatgtttattccctctgcagccagagtg
cattacggatgcgtcatgtgtgtcagaattctgcaaggtttagtggagggtgtgacctac
ccagcctgccatgggatgtggagtaagtgggcaccacctttggagagaagccgactggcc
acaacctctttttgtggttcctatgcaggggcagtggttgccatgcccctggctggggtg
ttggtgcagtacattggatggtcctctgtcttttatatttatggcatgtttgggattatt
tggtacatgttttggctgttgcaggcctatgagtgcccagcagctcatccaacaatatcc
aatgaggagaagacctatatagagacaagcataggagagggggccaacgtggttagtcta
agtaaatttagtaccccatggaaaagatttttcacatctttgccggtttatgcaatcatt
gtggcaaatttttgcagaagctggaccttttatttgctcctcataagtcagcctgcttat
tttgaagaggtctttggatttgcaataagtaaggtgggtctcttgtcagcagtcccacac
atggttatgacaatcgttgtacctattggaggacaattggctgattatttaagaagcaga
caaattttaaccacaactgctgtcagaaaaatcatgaactgtggaggttttggcatggag
gcaaccttactcctggtggttggcttttcgcataccaaaggggtggctatctcctttctg
gtacttgctgtaggatttagtggcttcgctatttcaggttttaatgtcaaccacctggac
attgccccacgctatgccagcattctcatggggatctcaaacggagtgggaaccctctct
ggaatggtctgtcccctcattgtcggtgcaatgaccaggcacaagacccgtgaagaatgg
cagaatgtgttcctcatagctgccctggtgcattacagtggtgtgatcttctatggggtc
tttgcttctggggagaaacaggagtgggctgacccagagaatctctctgaggagaaatgt
ggaatcattgaccaggacgaattagctgaggagatagaactcaaccatgagagttttgcg
agtcccaaaaagaagatgtcttatggagccacctcccagaattgtgaagtccagaagaag
gaatggaaaggacagagaggagcgacccttgatgaggaagagctgacatcctaccagaat
gaagagagaaacttctcaactatatcctaa

KEGG   Homo sapiens (human): 57030Help
Entry
57030             CDS       T01001                                 

Gene name
SLC17A7, BNPI, VGLUT1
Definition
(RefSeq) solute carrier family 17 member 7
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    57030 (SLC17A7)
   04723 Retrograde endocannabinoid signaling
    57030 (SLC17A7)
   04721 Synaptic vesicle cycle
    57030 (SLC17A7)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    57030 (SLC17A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    57030 (SLC17A7)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   57030 (SLC17A7)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    57030 (SLC17A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 57030
NCBI-ProteinID: NP_064705
OMIM: 605208
HGNC: 16704
Ensembl: ENSG00000104888
Vega: OTTHUMG00000183166
Pharos: Q9P2U7(Tbio)
UniProt: Q9P2U7
Position
19q13.33
AA seq 560 aa AA seqDB search
MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLP
RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLIH
GSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQG
LVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYV
YGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFT
SMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQ
IADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS
GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHY
GGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPS
YGATHSTFQPPRPPPPVRDY
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggagttccgccaggaggagtttcggaagctagcgggtcgtgctctcgggaagctgcac
cgccttctggagaagcggcaggaaggcgcggagacgctggagctgagtgcggatgggcgc
ccggtgaccacgcagacccgggacccgccggtggtggactgcacctgcttcggcctccct
cgccgctacattatcgccatcatgagtggtctgggcttctgcatcagctttggcatccgc
tgcaacctgggcgtggccatcgtctccatggtcaataacagcacgacccaccgcgggggc
cacgtggtggtgcagaaagcccagttcagctgggatccagagactgtcggcctcatacac
ggctcctttttctggggctacattgtcactcagattccaggaggatttatctgtcaaaaa
tttgcagccaacagagttttcggctttgctattgtggcaacatccactctaaacatgctg
atcccctcagctgcccgcgtccactatggctgtgtcatcttcgtgaggatcctgcagggg
ttggtagagggggtcacataccccgcctgccatgggatctggagcaaatgggccccaccc
ttagaacggagtcgcctggcgacgacagccttttgtggttcctatgctggggcggtggtc
gcgatgcccctcgccggggtccttgtgcagtactcaggatggagctctgttttctacgtc
tacggcagcttcgggatcttctggtacctgttctggctgctcgtctcctacgagtccccc
gcgctgcaccccagcatctcggaggaggagcgcaagtacatcgaggacgccatcggagag
agcgcgaaactcatgaaccccctcacgaagtttagcactccctggcggcgcttcttcacg
tctatgccagtctatgccatcatcgtggccaacttctgccgcagctggacgttctacctg
ctgctcatctcccagcccgcctacttcgaagaagtgttcggcttcgagatcagcaaggta
ggcctggtgtccgcgctgccccacctggtcatgaccatcatcgtgcccatcggcggccag
atcgcggacttcctgcggagccgccgcatcatgtccaccaccaacgtgcgcaagttgatg
aactgcggaggcttcggcatggaagccacgctgctgttggtggtcggctactcgcactcc
aagggcgtggccatctccttcctggtcctagccgtgggcttcagcggcttcgccatctct
gggttcaacgtgaaccacctggacatagccccgcgctacgccagcatcctcatgggcatc
tccaacggcgtgggcacactgtcgggcatggtgtgccccatcatcgtgggggccatgact
aagcacaagactcgggaggagtggcagtacgtgttcctaattgcctccctggtgcactat
ggaggtgtcatcttctacggggtctttgcttctggagagaagcagccgtgggcagagcct
gaggagatgagcgaggagaagtgtggcttcgttggccatgaccagctggctggcagtgac
gacagcgaaatggaggatgaggctgagcccccgggggcaccccctgcacccccgccctcc
tatggggccacacacagcacatttcagccccccaggcccccaccccctgtccgggactac
tga

KEGG   Homo sapiens (human): 57084Help
Entry
57084             CDS       T01001                                 

Gene name
SLC17A6, DNPI, VGLUT2
Definition
(RefSeq) solute carrier family 17 member 6
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    57084 (SLC17A6)
   04723 Retrograde endocannabinoid signaling
    57084 (SLC17A6)
   04721 Synaptic vesicle cycle
    57084 (SLC17A6)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    57084 (SLC17A6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    57084 (SLC17A6)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   57084 (SLC17A6)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    57084 (SLC17A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 BT1
Motif
Other DBs
NCBI-GeneID: 57084
NCBI-ProteinID: NP_065079
OMIM: 607563
HGNC: 16703
Ensembl: ENSG00000091664
Vega: OTTHUMG00000166063
Pharos: Q9P2U8(Tbio)
UniProt: Q9P2U8
Position
11p14.3
AA seq 582 aa AA seqDB search
MESVKQRILAPGKEGLKNFAGKSLGQIYRVLEKKQDTGETIELTEDGKPLEVPERKAPLC
DCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNWD
PETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCV
IFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT
GWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFK
TPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMT
IIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAV
GFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVF
LIAALVHYGGVIFYAIFASGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGT
TKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgtaaaacaaaggattttggccccaggaaaagaggggctaaagaattttgct
ggaaaatcactcggccagatctacagggtgctggagaagaagcaagacaccggggagaca
atcgagctgacggaggatgggaagcccctagaggtgcccgagaggaaggcgccgctgtgc
gactgcacgtgcttcggcctgccccgccgctacattatcgccatcatgagcggcctgggc
ttctgcatctccttcggtatccgctgcaacctgggcgtggccattgtggacatggtcaac
aacagcaccatccaccgcgggggcaaggtcatcaaggagaaagccaaattcaactgggac
ccggaaaccgtggggatgatccacggttccttcttttggggctacatcatcactcagatt
ccgggaggctacatcgcgtctcggctggcagccaacagggttttcggagctgccatactt
cttacctctaccctaaatatgctaattccatcagcagccagagtgcattatggatgtgtc
atctttgtcagaatactgcagggacttgttgagggtgtgacctacccagcatgtcatggg
atatggagcaaatgggccccacctctagagaggagtagactggcaaccacctccttttgt
ggttcctatgccggagctgtgattgcaatgcctttagctggcattcttgtgcagtacact
ggctggtcttcagtgttttatgtctacggaagctttggaatggtctggtacatgttttgg
cttttggtgtcttatgaaagtcctgcaaagcatcctactattacagatgaagaacgtagg
tacatagaagaaagcattggagagagtgcaaatcttttaggtgcaatggaaaaattcaag
actccatggaggaagttttttacatccatgccagtctatgcaataattgttgcaaacttc
tgcagaagctggactttttatttattgcttattagtcagccagcatattttgaggaagtc
tttggatttgaaattagcaaggttggtatgctatctgctgtgccacacttagtaatgaca
attattgtgcctattgggggacaaattgcagattttctaagaagcaagcagattctttca
actacgacagtgagaaagatcatgaattgtggtggttttggcatggaagccacactgctc
ctggtcgttggctattctcatactagaggggtagcaatctcattcttggtacttgcagtg
ggattcagtggatttgctatatctggtttcaatgttaaccacttggatatcgctccaaga
tatgccagtatcttaatgggcatttcgaatggtgttggcacattgtcaggaatggtttgt
cctatcattgttggtgcaatgacaaagaataagtcacgtgaagagtggcagtatgtcttc
ctgatcgctgccctagtccactatggtggagttatattttatgcaatatttgcctcagga
gagaaacaaccctgggcagacccggaggaaacaagtgaagaaaaatgtggatttattcat
gaagatgaactcgatgaagaaacaggggacattactcaaaattatataaattatggtacc
accaagtcttatggtgccacaacacaggccaatggaggttggcctagtggttgggaaaag
aaagaggaatttgtacaaggagaagtacaagactcacatagctataaggaccgagttgat
tattcataa

DBGET integrated database retrieval system