KEGG   Homo sapiens (human): 246243Help
Entry
246243            CDS       T01001                                 

Gene name
RNASEH1, H1RNA, PEOB2, RNH1
Definition
(RefSeq) ribonuclease H1
  KO
K03469  ribonuclease HI [EC:3.1.26.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
Disease
H01395  Autosomal recessive progressive external ophthalmoplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    246243 (RNASEH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    246243 (RNASEH1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     246243 (RNASEH1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    246243 (RNASEH1)
 Prokaryotic type
   Elongation factors (bacterial)
    RNase H
     246243 (RNASEH1)
   Elongation factors (archaeal)
     246243 (RNASEH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNase_H Cauli_VI RVT_3
Motif
Other DBs
NCBI-GeneID: 246243
NCBI-ProteinID: NP_002927
OMIM: 604123
HGNC: 18466
Ensembl: ENSG00000171865
Vega: OTTHUMG00000090279
Pharos: O60930(Tchem)
UniProt: O60930 E5KN15
Structure
PDB: 

Position
2p25.3
AA seq 286 aa AA seqDB search
MSWLLFLAHRVALAALPCRRGSRGFGMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKK
FATEDEAWAFVRKSASPEVSEGHENQHGQESEAKASKRLREPLDGDGHESAEPYAKHMKP
SVEPAPPVSRDTFSYMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQ
TNQRAEIHAACKAIEQAKTQNINKLVLYTDSMFTINGITNWVQGWKKNGWKTSAGKEVIN
KEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcttctgttcctggcccacagagtcgccttggccgccttgccctgccgccgc
ggctctcgcgggttcgggatgttctatgccgtgaggaggggccgcaagaccggggtcttt
ctgacctggaatgagtgcagagcacaggtggaccggtttcctgctgccagatttaagaag
tttgccacagaggatgaggcctgggcctttgtcaggaaatctgcaagcccggaagtttca
gaagggcatgaaaatcaacatggacaagaatcggaggcgaaagccagcaagcgactccgt
gagccactggatggagatggacatgaaagcgcagagccgtatgcaaagcacatgaagccg
agcgtggagccggcgcctccagttagcagagacacgttttcctacatgggagacttcgtc
gtcgtctacactgatggctgctgctccagtaatgggcgtagaaggccgcgagcaggaatc
ggcgtttactgggggccaggccatcctttaaatgtaggcattagacttcctgggcggcag
acaaaccaaagagcggaaattcatgcagcctgcaaagccattgaacaagcaaagactcaa
aacatcaataaactggttctgtatacagacagtatgtttacgataaatggtataactaac
tgggttcaaggttggaagaaaaatgggtggaagacaagtgcagggaaagaggtgatcaac
aaagaggactttgtggcactggagaggcttacccaggggatggacattcagtggatgcat
gttcctggtcattcgggatttataggcaatgaagaagctgacagattagccagagaagga
gctaaacaatcggaagactga

DBGET integrated database retrieval system