KEGG   Homo sapiens (human): 246330Help
Entry
246330            CDS       T01001                                 

Gene name
PELI3
Definition
(RefSeq) pellino E3 ubiquitin protein ligase family member 3
  KO
K11964  pellino [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    246330 (PELI3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     246330 (PELI3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Pellino proteins
    246330 (PELI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pellino zf-C3HC4_3 zf-RING_2
Motif
Other DBs
NCBI-GeneID: 246330
NCBI-ProteinID: NP_659502
OMIM: 609827
HGNC: 30010
Ensembl: ENSG00000174516
Vega: OTTHUMG00000167109
Pharos: Q8N2H9(Tbio)
UniProt: Q8N2H9 A0A024R5B1
Position
11q13.2
AA seq 469 aa AA seqDB search
MVLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLGCCEEGGEET
EAQRGEVTGPRAHSCYNGCLASGDKGRRRSRLALSRRSHANGVKPDVMHHISTPLVSKAL
SNRGQHSISYTLSRSHSVIVEYTHDSDTDMFQIGRSTENMIDFVVTDTSPGGGAAEGPSA
QSTISRYACRILCDRRPPYTARIYAAGFDASSNIFLGERAAKWRTPDGLMDGLTTNGVLV
MHPAGGFSEDSAPGVWREISVCGNVYTLRDSRSAQQRGKLVENESNVLQDGSLIDLCGAT
LLWRTPAGLLRAPTLKQLEAQRQEANAARPQCPVGLSTLAFPSPARGRTAPDKQQPWVYV
RCGHVHGYHGWGCRRERGPQERECPLCRLVGPYVPLWLGQEAGLCLDPGPPSHAFAPCGH
VCSEKTARYWAQTPLPHGTHAFHAACPFCGAWLTGEHGCVRLIFQGPLD
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggtgctggaaggaaaccctgaagtggggtccccccgaacctcagacctccagcaccgg
gggaacaagggctcttgcgttctctcctctcccggtgaagatgcgcagccaggcgaggag
cccatcaagtatggtgaactcatcgtcctgggatgctgtgaggaaggaggtgaggaaacc
gaggctcagagaggggaagtgactggcccaagggcacacagctgctacaatggttgtctg
gcaagtggggacaagggccgccggcgaagccgcctggcactgagccgccggtcgcacgcc
aacggggtgaagccagacgtcatgcaccacatctccacgccgctcgtctccaaggcactg
agtaaccgtggtcagcacagcatctcgtatacactgtcccggagccactcggtcatagtg
gagtatacacatgatagcgacacagacatgttccagattggccgctccacagagaacatg
attgacttcgtggtaacagacacgtcccctggaggaggggctgccgagggcccttctgcc
cagagcaccatctcccgctatgcctgccgcatcctctgtgaccgccggccaccctatact
gcccgcatctatgccgctggcttcgatgcctctagcaacatcttccttggagagcgagcg
gccaaatggcggaccccagatggcctgatggatggactgaccaccaatggagtcctggtg
atgcacccggcaggcggcttctccgaggactcagccccgggtgtctggcgggagatctcg
gtctgtgggaatgtgtacacattgcgggacagccgctcagcccagcagcggggcaagctg
gtggaaaacgagtccaacgtgctgcaggacggctctctcatcgacctgtgtggggccaca
ctgctgtggcgcacaccggcggggctgctgcgggctcccacactgaagcaactggaggcc
cagcggcaggaggcaaatgcagcgcggccccagtgccccgtgggcctcagcactctggcc
ttccccagcccagcccgtggccgcacagcgcccgacaaacagcagccctgggtctacgtc
cgctgcgggcacgtccatggctaccacggctggggctgccggcgggagcggggcccccag
gagcgcgaatgtcctctctgccgccttgtggggccttatgtgcctctatggcttggccag
gaggccggcctctgcctggaccctgggccgcctagccatgcctttgcaccttgcggccac
gtctgctctgagaagactgcccgctactgggcccagacaccactgccccacggcacccat
gctttccatgccgcctgccccttttgcggggcctggcttaccggcgagcatggctgcgtc
cgcctcattttccagggcccgctggattag

DBGET integrated database retrieval system