KEGG   Homo sapiens (human): 246721Help
Entry
246721            CDS       T01001                                 

Gene name
POLR2J2, HRPB11B, POLR2J3, RPB11b1, RPB11b2
Definition
(RefSeq) RNA polymerase II subunit J2
  KO
K03008  DNA-directed RNA polymerase II subunit RPB11
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    246721 (POLR2J2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    246721 (POLR2J2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    246721 (POLR2J2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    246721 (POLR2J2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     246721 (POLR2J2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      246721 (POLR2J2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_L_2 RNA_pol_L
Motif
Other DBs
NCBI-GeneID: 246721
NCBI-ProteinID: NP_116581
OMIM: 609881
HGNC: 23208
Ensembl: ENSG00000267645
Vega: OTTHUMG00000180801
UniProt: Q9GZM3
Position
7q22.1
AA seq 115 aa AA seqDB search
MNAPPAFESFLLFEGEKITINKDTKVPKACLFTINKEDHTLGNIIKSQLLKDPQVLFAGY
KVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccctccagccttcgagtcgttcttgctcttcgagggcgagaagatcaccatt
aacaaggacaccaaggtacccaaggcctgcttattcaccatcaacaaagaagaccacaca
ctgggaaacatcattaaatcacaactcctaaaagacccgcaagtgctatttgctggctac
aaagtcccccaccccttggagcacaagatcatcatccgagtgcagaccacgccggactac
agcccccaggaagcctttaccaacgccatcaccgacctcatcagtgagctgtccctgctg
gaggagcgcttccggacgtgcctgcttccccttcgccttctgccgtga

KEGG   Homo sapiens (human): 5430Help
Entry
5430              CDS       T01001                                 

Gene name
POLR2A, POLR2, POLRA, RPB1, RPBh1, RPO2, RPOL2, RpIILS, hRPB220, hsRPB1
Definition
(RefSeq) RNA polymerase II subunit A
  KO
K03006  DNA-directed RNA polymerase II subunit RPB1 [EC:2.7.7.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5430 (POLR2A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5430 (POLR2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5430 (POLR2A)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5430 (POLR2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     5430 (POLR2A)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     5430 (POLR2A)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5430 (POLR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_6 RNA_pol_Rpb1_7 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4 RNA_pol_Rpb1_R
Motif
Other DBs
NCBI-GeneID: 5430
NCBI-ProteinID: NP_000928
OMIM: 180660
HGNC: 9187
Ensembl: ENSG00000181222
Vega: OTTHUMG00000177594
Pharos: P24928(Tbio)
UniProt: P24928
Structure
PDB: 

Position
17p13.1
AA seq 1970 aa AA seqDB search
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN
NT seq 5913 nt NT seq  +upstreamnt  +downstreamnt
atgcacgggggtggccccccctcgggggacagcgcatgcccgctgcgcaccatcaagaga
gtccagttcggagtcctgagtccggatgaactgaagcgaatgtctgtgacggagggtggc
atcaaatacccagagacgactgagggaggccgccccaagcttggggggctgatggacccg
aggcagggggtgattgagcggactggccgctgccaaacatgtgcaggaaacatgacagag
tgtcctggccactttggccacattgaactggccaagcctgtgtttcacgtgggcttcctg
gtgaagacaatgaaagttttgcgctgtgtctgcttcttctgctccaaactgcttgtggac
tctaacaacccaaagatcaaggatatcctggctaagtccaagggacagcccaagaagcgg
ctcacacatgtctacgacctttgcaagggcaaaaacatatgcgagggtggggaggagatg
gacaacaagttcggtgtggaacaacctgagggtgacgaggatctgaccaaagaaaagggc
catggtggctgtgggcggtaccagcccaggatccggcgttctggcctagagctgtatgcg
gaatggaagcacgttaatgaggactctcaggagaagaagatcctgctgagtccagagcga
gtgcatgagatcttcaaacgcatctcagatgaggagtgttttgtgctgggcatggagccc
cgctatgcacggccagagtggatgattgtcacagtgctgcctgtgcccccgctctccgtg
cggcctgctgttgtgatgcagggctctgcccgtaaccaggatgacctgactcacaaactg
gctgacatcgtgaagatcaacaatcagctgcggcgcaatgagcagaacggcgcagcggcc
catgtcattgcagaggatgtgaagctcctccagttccatgtggccaccatggtggacaat
gagctgcctggcttgccccgtgccatgcagaagtctgggcgtcccctcaagtccctgaag
cagcggttgaagggcaaggaaggccgggtgcgagggaacctgatgggcaaaagagtggac
ttctcggcccgtactgtcatcacccccgaccccaacctctccattgaccaggttggcgtg
ccccgctccattgctgccaacatgacctttgcggagattgtcacccccttcaacattgac
agacttcaagaactagtgcgcagggggaacagccagtacccaggcgccaagtacatcatc
cgagacaatggtgatcgcattgacttgcgtttccaccccaagcccagtgaccttcacctg
cagaccggctataaggtggaacggcacatgtgtgatggggacattgttatcttcaaccgg
cagccaactctgcacaaaatgtccatgatggggcatcgggtccgcattctcccatggtct
acctttcgcttgaatcttagtgtgacaactccgtacaatgcagactttgacggggatgag
atgaacttgcacctgccacagtctctggagacgcgagcagagatccaggagctggccatg
gttcctcgcatgattgtcaccccccagagcaatcggcctgtcatgggtattgtgcaggac
acactcacagcagtgcgcaaattcaccaagagagacgtcttcctggagcggggtgaagtg
atgaacctcctgatgttcctgtcgacgtgggatgggaaggtcccacagccggccatccta
aagccccggcccctgtggacaggcaagcaaatcttctccctcatcatacctggtcacatc
aattgtatccgtacccacagcacccatcccgatgatgaagacagtggcccttacaagcac
atctctcctggggacaccaaggtggtggtggagaatggggagctgatcatgggcatcctg
tgtaagaagtctctgggcacgtcagctggctccctggtccacatctcctacctagagatg
ggtcatgacatcactcgcctcttctactccaacattcagactgtcattaacaactggctc
ctcatcgagggtcatactattggcattggggactccattgctgattctaagacttaccag
gacattcagaacactattaagaaggccaagcaggacgtaatagaggtcatcgagaaggca
cacaacaatgagctggagcccaccccagggaacactctgcggcagacgtttgagaatcag
gtgaaccgcattcttaacgatgcccgagacaagactggctcctctgctcagaaatccctg
tctgaatacaataacttcaagtctatggtcgtgtccggagctaaaggttccaagattaac
atctcccaggtcattgctgtcgttggacagcagaacgtcgagggcaagcggattccattt
ggcttcaagcaccggactctgcctcacttcatcaaggatgactacgggcctgagagccgt
ggctttgtggagaactcctacctagccggcctcacacccactgagttctttttccacgcc
atggggggtcgtgaggggctcattgacacggctgtcaagactgctgagactggatacatc
cagcggcggctgatcaagtccatggagtcagtgatggtgaagtacgacgcgactgtgcgg
aactccatcaaccaggtggtgcagctgcgctacggcgaagacggcctggcaggcgagagc
gttgagttccagaacctggctacgcttaagccttccaacaaggcttttgagaagaagttc
cgctttgattataccaatgagagggccctgcggcgcactctgcaggaggacctggtgaag
gacgtgctgagcaacgcacacatccagaacgagttggagcgggaatttgagcggatgcgg
gaggatcgggaggtgctcagggtcatcttcccaactggagacagcaaggtcgtcctcccc
tgtaacctgctgcggatgatctggaatgctcagaaaatcttccacatcaacccacgcctt
ccctccgacctgcaccccatcaaagtggtggagggagtcaaggaattgagcaagaagctg
gtgattgtgaatggggatgacccactaagtcgacaggcccaggaaaatgccacgctgctc
ttcaacatccacctgcggtccacgttgtgttcccgccgcatggcagaggagtttcggctc
agtggggaggccttcgactggctgcttggggagattgagtccaagttcaaccaagccatt
gcgcatcccggggaaatggtgggggctctggctgcgcagtcccttggagaacctgccacc
cagatgaccttgaataccttccactatgctggtgtgtctgccaagaatgtgacgctgggt
gtgccccgacttaaggagctcatcaacatttccaagaagccaaagactccttcgcttact
gtcttcctgttgggccagtccgctcgagatgctgagagagccaaggatattctgtgccgt
ctggagcatacaacgttgaggaaggtgactgccaacacagccatctactatgaccccaac
ccccagagcacggtggtggcagaggatcaggaatgggtgaatgtctactatgaaatgcct
gactttgatgtggcccgaatctccccctggctgttgcgggtggagctggatcggaagcac
atgactgaccggaagctcaccatggagcagattgctgaaaagatcaatgctggttttggt
gacgacttgaactgcatctttaatgatgacaatgcagagaagctggtgctccgtattcgc
atcatgaacagcgatgagaacaagatgcaagaggaggaagaggtggtggacaagatggat
gatgatgtcttcctgcgctgcatcgagtccaacatgctgacagatatgaccctgcagggc
atcgagcagatcagcaaggtgtacatgcacttgccacagacagacaacaagaagaagatc
atcatcacggaggatggggaattcaaggccctgcaggagtggatcctggagacggacggc
gtgagcttgatgcgggtgctgagtgagaaggacgtggaccccgtacgcaccacgtccaat
gacattgtggagatcttcacggtgctgggcattgaagccgtgcggaaggccctggagcgg
gagctgtaccacgtcatctcctttgatggctcctatgtcaattaccgacacttggctctc
ttgtgtgataccatgacctgtcgtggccacttgatggccatcacccgacacggagtcaac
cgccaggacacaggaccactcatgaagtgttcctttgaggaaacggtggacgtgcttatg
gaagcagccgcacacggtgagagtgaccccatgaagggggtctctgagaatatcatgctg
ggccagctggctccggccggcactggctgctttgacctcctgcttgatgcagagaagtgc
aagtatggcatggagatccccaccaatatccccggcctgggggctgctggacccaccggc
atgttctttggttcagcacccagtcccatgggtggaatctctcctgccatgacaccttgg
aaccagggtgcaacccctgcctatggcgcctggtcccccagtgttgggagtggaatgacc
ccaggggcagccggcttctctcccagtgctgcgtcagatgccagcggcttcagcccaggt
tactcccctgcctggtctcccacaccgggctccccggggtccccaggtccctcaagcccc
tacatcccttcaccaggtggtgccatgtctcccagctactcgccaacgtcacctgcctac
gagccccgctctcctgggggctacacaccccagagtccctcttattcccccacttcaccc
tcctactcccctacctctccatcctattctccaaccagtcccaactatagtcccacatca
cccagctattcgccaacgtcacccagctactcaccgacctctcccagctactcacccacc
tctcccagctactcgcccacctctcccagctactcgcccacctctcccagctactcaccc
acttcccctagctactcgcccacttcccctagctactcgccaacgtctcccagctactcg
ccgacatctcccagctactcgccaacttcacccagctattctcccacttctcccagctac
tcacctacctctccaagctattcacccacctcccccagctactcacccacttccccaagt
tactcacccaccagcccgaactattctccaaccagtcccaattacaccccaacatcaccc
agctacagcccgacatcacccagctattcacctactagtcccaactacacacctaccagc
cctaactacagcccaacctctccaagctactctccaacatcacccagctattccccgacc
tcaccaagttactccccttccagcccacgatacacaccacagtctccaacctatacccca
agctcacccagctacagccccagctcgcccagctacagcccaacctcacccaagtacacc
ccaaccagtccttcttacagtcccagctccccagagtataccccaacctctcccaagtac
tcacctaccagtcccaaatattcacccacctctcccaagtactcgcctaccagtcccacc
tattcacccaccaccccaaaatactccccaacatctcctacttattccccaacctctcca
gtctacaccccaacctctcccaagtactcacctactagccccacttactcgcccacttcc
cccaagtactcgcccaccagccccacctactcgcccacctcccccaaaggctcaacctac
tctcccacttcccctggttactcgcccaccagccccacctacagtctcacaagcccggct
atcagcccggatgacagtgacgaggagaactga

KEGG   Homo sapiens (human): 5431Help
Entry
5431              CDS       T01001                                 

Gene name
POLR2B, POL2RB, RPB2, hRPB140
Definition
(RefSeq) RNA polymerase II subunit B
  KO
K03010  DNA-directed RNA polymerase II subunit RPB2 [EC:2.7.7.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5431 (POLR2B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5431 (POLR2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5431 (POLR2B)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5431 (POLR2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     5431 (POLR2B)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     5431 (POLR2B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5431 (POLR2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_2 RNA_pol_Rpb2_7 RNA_pol_Rpb2_4 RNA_pol_Rpb2_3 RNA_pol_Rpb2_5 Amidoligase_2
Motif
Other DBs
NCBI-GeneID: 5431
NCBI-ProteinID: NP_000929
OMIM: 180661
HGNC: 9188
Ensembl: ENSG00000047315
Vega: OTTHUMG00000128771
Pharos: P30876(Tbio)
UniProt: P30876 B4DH29
Structure
PDB: 

Position
4q12
AA seq 1174 aa AA seqDB search
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacgcggatgaggatatgcaatatgatgaggatgatgatgaaatcaccccggat
ttgtggcaagaagcatgctggattgtaatcagttcctattttgacgagaaaggcttggtt
agacaacagctggattcttttgatgagtttattcagatgtctgttcaaagaattgtggaa
gacgctcctcctatagacctacaggctgaagctcagcatgctagtggagaagttgaagaa
ccgccacgatatttgctgaagtttgaacaaatttatctttccaagcctacccattgggaa
agagatggtgctccttcaccaatgatgcccaatgaagctagattaaggaatctcacgtat
tctgctccgctttatgttgatataacaaaaacagtcattaaagaaggtgaagaacaactt
cagactcagcatcagaaaacttttataggaaaaattccaattatgttgcggtcaacttac
tgccttttgaatggcttgacagatcgtgatctttgtgagttaaatgaatgccctttggat
cctggtggctatttcattattaatggatcagaaaaggttctgattgcccaagagaaaatg
gcaacaaacacagtttatgtgtttgccaaaaaggattctaaatatgcctacacaggagag
tgtagatcatgtcttgagaattcttcccgacccaccagtactatatgggttagcatgctg
gcaagaggaggacagggtgccaagaagagtgctattggtcagcgcattgtggcaactcta
ccatatatcaagcaagaagttcccatcattattgtgttcagagcattaggttttgtgtcc
gacagagatattttagaacatattatttatgattttgaagatccagagatgatggaaatg
gttaaaccttctctcgatgaagcttttgtcatccaagaacagaatgttgcactaaatttc
attggttcaagaggagcaaagcctggtgttactaaagagaaaagaattaaatatgcaaag
gaagttttacaaaaagaaatgctccctcatgttggtgtcagtgatttttgtgagaccaaa
aaagcctatttcttgggatacatggttcataggttacttctggcagctttgggtagaaga
gaactagatgacagagatcactatggaaacaagagattggatcttgctgggccgctgctt
gcattcttatttagaggtatgtttaagaatttgcttaaagaagtgcggatctatgcacag
aaatttattgatcgaggaaaggattttaacttggagttggcaattaaaacacggatcata
tctgatggcctaaaatactctttagctactggaaactggggtgatcaaaagaaagctcat
caagccagagctggagtatctcaggtgttaaaccgcctgacttttgcgtctactctttct
cacctgcgtcgtttaaattctcctattggtagagacggcaagctagcaaaaccaagacag
ttgcataatacgttgtggggaatggtgtgtcctgccgagaccccagagggccatgctgta
ggacttgtgaagaatttagccttgatggcgtatatttcagttggatctcaaccatctcca
attctggaatttttagaagaatggagtatggaaaatttagaagaaatttctcctgcagct
attgctgatgcaaccaagatttttgttaatggctgctgggttggaatacataaagatccc
gaacaacttatgaacaccctaaggaaattgagacgtcagatggacatcattgtgtctgaa
gtttctatgatcagagatattcgagagagggagattcggatctatacggatgcaggccgt
atttgtagaccacttctgattgtggaaaaacaaaagctacttttgaagaagaggcatatt
gaccaattgaaagagagagaatataacaactatagttggcaggatcttgtggccagtggg
gtagtggagtatattgataccctggaagaagaaacagtgatgcttgcaatgactccagat
gatttacaggagaaagaagtagcttattgttccacatatacacactgtgagattcatccc
tcaatgatccttggtgtctgtgcatctattattccctttcctgatcataaccagtcccct
agaaacacataccagtctgctatgggtaagcaggctatgggagtttacatcaccaacttc
catgttcgcatggacacattggcccatgttctctattatcctcaaaagccacttgtgact
acacggtctatggaatatctacgatttagagagctgccagcaggcatcaactcaattgtg
gccattgcatcatacactggatataatcaggaagactctgttatcatgaatcgttcagct
gtagaccgcggcttcttcaggtctgttttctatcgctcatacaaagaacaggagtctaaa
aaaggatttgatcaagaagaagtttttgagaagcctacacgtgaaacatgccagggcatg
aggcatgccatttacgacaagctggatgatgatggtttgatagctccaggggttcgtgta
tcaggagatgatgttattataggcaaaacagtcaccttgcctgaaaatgaagatgaattg
gagagcaccaatagacgctataccaagagagactgtagcacttttctcagaactagcgag
acgggcattgtggatcaggttatggtaactctcaatcaggaaggatataaattttgtaaa
ataagggtacgctctgttaggattccacagattggagacaaatttgctagtcgacatggt
caaaagggtacttgtggtattcagtatagacaagaggatatgcctttcacctgtgaaggt
atcacccctgatatcatcatcaatccccatgccatcccctctcgtatgactattggtcac
ttaattgaatgccttcaagggaaggtatcggctaacaagggtgaaattggtgatgccact
ccatttaatgatgctgttaacgtgcagaagatttctaatcttttatctgattatggctat
catctcagaggaaatgaggtcctgtacaatgggttcactggtcgaaaaatcacatcacaa
atatttattggccccacttattaccagcgtttgaagcatatggtggatgataagattcac
tctcgtgctaggggacctattcagatcctcaatagacagcccatggagggtagatctcgt
gatggtggcctgcgttttggagaaatggaacgagattgtcagattgcccatggagcagcc
cagtttttaagggaaagattgtttgaggcatcagatccatatcaggttcatgtttgcaat
ctttgtggaataatggcgattgccaacaccaggacccatacatatgaatgcaggggctgc
cgcaataaaacccagatttctttggtgcgaatgccttacgcatgcaaactattgtttcag
gaacttatgtctatgagtattgcaccgcgaatgatgagtgtttag

KEGG   Homo sapiens (human): 5432Help
Entry
5432              CDS       T01001                                 

Gene name
POLR2C, RPB3, RPB31, hRPB33, hsRPB3
Definition
(RefSeq) RNA polymerase II subunit C
  KO
K03011  DNA-directed RNA polymerase II subunit RPB3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5432 (POLR2C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5432 (POLR2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5432 (POLR2C)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5432 (POLR2C)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     5432 (POLR2C)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5432 (POLR2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_A_bac RNA_pol_L
Motif
Other DBs
NCBI-GeneID: 5432
NCBI-ProteinID: NP_116558
OMIM: 180663
HGNC: 9189
Ensembl: ENSG00000102978
Vega: OTTHUMG00000133464
Pharos: P19387(Tbio)
UniProt: P19387 Q6FGR6
Structure
PDB: 

Position
16q21
AA seq 275 aa AA seqDB search
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLISDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacgccaaccagcctaccgtgcggatcacggagctcactgacgagaatgtcaag
ttcatcatcgagaacaccgacctggcggtggccaattcgattcggagggtcttcatcgct
gaggttcccataatagccattgactgggttcagattgatgccaattcctcagttcttcat
gatgaattcattgctcacaggcttggattaattcccctcattagtgatgacattgtggac
aagctgcagtactctcgggactgcacatgtgaggagttctgccccgagtgctcggtggag
ttcaccctcgatgtgcggtgcaatgaagaccagacgcgacatgtcacgtctcgagacctc
atctccaacagcccccgggtcattccggtgacatcccggaaccgagataatgaccccaat
gactacgtggagcaggatgacatcctcatcgtcaagttgagaaagggccaggagctgaga
cttcgagcctatgccaaaaagggctttggcaaggagcatgccaagtggaaccctactgca
ggggtggcttttgaatacgatccagacaatgccctgaggcacacagtgtaccccaagccc
gaggaatggccaaagagtgagtactcggagctggatgaggatgagtcgcaggctccctat
gaccccaacggcaagccagaaaggttttactacaatgtggagtcctgtggctctctgcgt
cctgaaaccattgtcctgtcagccctctcaggattgaagaagaaactgagtgatttacaa
actcaattaagccacgagatccagagtgatgtgctaaccataaattaa

KEGG   Homo sapiens (human): 5433Help
Entry
5433              CDS       T01001                                 

Gene name
POLR2D, HSRBP4, HSRPB4, RBP4, RPB16
Definition
(RefSeq) RNA polymerase II subunit D
  KO
K03012  DNA-directed RNA polymerase II subunit RPB4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5433 (POLR2D)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5433 (POLR2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5433 (POLR2D)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5433 (POLR2D)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     5433 (POLR2D)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5433 (POLR2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpb4 Maelstrom Tfb4
Motif
Other DBs
NCBI-GeneID: 5433
NCBI-ProteinID: NP_004796
OMIM: 606017
HGNC: 9191
Ensembl: ENSG00000144231
Vega: OTTHUMG00000131531
Pharos: O15514(Tdark)
UniProt: O15514 A0A024RAJ4
Structure
PDB: 

Position
2q14.3
AA seq 142 aa AA seqDB search
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgggtggcagcgatccgcgggctggcgacgtagaggaggacgcctcacagctc
atctttcctaaagagtttgaaacagctgagacacttctaaattcagaagttcatatgctt
ctggaacatcgaaagcagcagaatgagagtgcagaggacgaacaggagctctcagaagtc
ttcatgaaaacattaaactacacagcccgtttcagtcgtttcaaaaacagagagaccatt
gccagtgttcgtagcttgctactccagaaaaagcttcataagtttgagttggcctgtttg
gccaacctttgcccagagactgctgaggagtccaaggctctaatcccaagcttggaggga
cggtttgaagatgaggagctgcagcagattcttgatgatatccagacaaagcgcagcttt
cagtattaa

KEGG   Homo sapiens (human): 5434Help
Entry
5434              CDS       T01001                                 

Gene name
POLR2E, RPABC1, RPB5, XAP4, hRPB25, hsRPB5
Definition
(RefSeq) RNA polymerase II subunit E
  KO
K03013  DNA-directed RNA polymerases I, II, and III subunit RPABC1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5434 (POLR2E)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    5434 (POLR2E)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5434 (POLR2E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5434 (POLR2E)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5434 (POLR2E)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     5434 (POLR2E)
  RNA polymerase III system
   RNA polymerase III
     5434 (POLR2E)
  RNA polymerase I system
   RNA polymerase I
     5434 (POLR2E)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5434 (POLR2E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpb5_C RNA_pol_Rpb5_N
Motif
Other DBs
NCBI-GeneID: 5434
NCBI-ProteinID: NP_002686
OMIM: 180664
HGNC: 9192
Ensembl: ENSG00000099817
Vega: OTTHUMG00000181873
Pharos: P19388(Tbio)
UniProt: P19388
Structure
PDB: 

Position
19p13.3
AA seq 210 aa AA seqDB search
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgaggaggagacgtaccggctctggaaaatccgcaagaccatcatgcagctg
tgccacgaccgtggctatctggtgacccaggacgagcttgaccagaccctggaggagttc
aaagcccaatttggggacaagccgagtgaggggcggccgcggcgcacggacctcaccgtg
ctggtggcccacaacgatgaccccaccgaccagatgtttgtgttctttccagaggagccc
aaggtgggcatcaagaccatcaaggtgtactgccagcgcatgcaggaggagaacatcaca
cgggctctcatcgtggtgcagcagggcatgacaccctccgccaagcagtccctggtcgac
atggcccccaagtacatcctggagcagtttctgcagcaggagctgctcatcaacatcacg
gagcacgagctagtccctgagcacgtcgtcatgaccaaggaggaggtgacagagctgctg
gcccgatataagctccgagagaaccagctgcccaggatccaggcgggggaccctgtggcg
cgctactttgggataaagcgtgggcaggtggtgaagatcatccggcccagtgagacggct
ggcaggtacatcacctaccggctggtgcagtag

KEGG   Homo sapiens (human): 5435Help
Entry
5435              CDS       T01001                                 

Gene name
POLR2F, HRBP14.4, POLRF, RPABC14.4, RPABC2, RPB14.4, RPB6, RPC15
Definition
(RefSeq) RNA polymerase II subunit F
  KO
K03014  DNA-directed RNA polymerases I, II, and III subunit RPABC2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5435 (POLR2F)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    5435 (POLR2F)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5435 (POLR2F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5435 (POLR2F)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5435 (POLR2F)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     5435 (POLR2F)
  RNA polymerase III system
   RNA polymerase III
     5435 (POLR2F)
  RNA polymerase I system
   RNA polymerase I
     5435 (POLR2F)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5435 (POLR2F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpb6 BDHCT_assoc
Motif
Other DBs
NCBI-GeneID: 5435
NCBI-ProteinID: NP_068809
OMIM: 604414
HGNC: 9193
Ensembl: ENSG00000100142
Vega: OTTHUMG00000151160
Pharos: P61218(Tbio)
UniProt: P61218
Structure
PDB: 

Position
22q13.1
AA seq 127 aa AA seqDB search
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIITD
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaacgaggacaattttgatggcgacgactttgatgatgtggaggaggatgaa
gggctagatgacttggagaatgccgaagaggaaggccaggagaatgtcgagatcctcccc
tctggggagcgaccgcaggccaaccagaagcgaatcaccacaccatacatgaccaagtac
gagcgagcccgcgtgctgggcacccgagcgctccagattgcgatgtgtgcccctgtgatg
gtggagctggagggggagacagatcctctgctcattgccatgaaggaactcaaggcccga
aagatccccatcatcattcgccgttacctgccagatgggagctatgaagactggggggtg
gacgagctcatcatcaccgactga

KEGG   Homo sapiens (human): 5436Help
Entry
5436              CDS       T01001                                 

Gene name
POLR2G, RPB19, RPB7, hRPB19, hsRPB7
Definition
(RefSeq) RNA polymerase II subunit G
  KO
K03015  DNA-directed RNA polymerase II subunit RPB7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5436 (POLR2G)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5436 (POLR2G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5436 (POLR2G)
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5436 (POLR2G)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5436 (POLR2G)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     5436 (POLR2G)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     5436 (POLR2G)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5436 (POLR2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S1 SHS2_Rpb7-N RNA_pol_Rbc25
Motif
Other DBs
NCBI-GeneID: 5436
NCBI-ProteinID: NP_002687
OMIM: 602013
HGNC: 9194
Ensembl: ENSG00000168002
Vega: OTTHUMG00000167609
Pharos: P62487(Tbio)
UniProt: P62487
Structure
PDB: 

Position
11q12.3
AA seq 172 aa AA seqDB search
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgttctaccatatctccctagagcacgaaatcctgctgcacccgcgctacttcggcccc
aacttgctcaacacggtgaagcagaagctcttcaccgaggtggaggggacctgcacaggg
aagtatggctttgtaattgctgtcaccaccattgacaatattggtgctggtgtgatccag
ccaggccgaggctttgtcctttatccagttaagtacaaggccattgttttccggccattt
aaaggggaggtcgtggatgctgttgtcactcaggtcaacaaggttggactcttcacagaa
attgggcccatgtcttgcttcatctctcgacattccatcccttcagagatggagtttgat
cctaactccaacccaccatgttacaagacaatggatgaggatattgtgattcagcaggac
gatgagatccgcttaaagattgtggggacccgtgtggacaagaatgacatttttgctatt
ggctccctgatggacgattacttggggcttgtaagctga

KEGG   Homo sapiens (human): 5437Help
Entry
5437              CDS       T01001                                 

Gene name
POLR2H, RPABC3, RPB17, RPB8
Definition
(RefSeq) RNA polymerase II subunit H
  KO
K03016  DNA-directed RNA polymerases I, II, and III subunit RPABC3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5437 (POLR2H)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    5437 (POLR2H)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5437 (POLR2H)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5437 (POLR2H)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5437 (POLR2H)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     5437 (POLR2H)
  RNA polymerase III system
   RNA polymerase III
     5437 (POLR2H)
  RNA polymerase I system
   RNA polymerase I
     5437 (POLR2H)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5437 (POLR2H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpb8 RNA_pol_RpbG
Motif
Other DBs
NCBI-GeneID: 5437
NCBI-ProteinID: NP_006223
OMIM: 606023
HGNC: 9195
Ensembl: ENSG00000163882
Vega: OTTHUMG00000156746
Pharos: P52434(Tbio)
UniProt: P52434
Structure
PDB: 

Position
3q27.1
AA seq 150 aa AA seqDB search
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcatcctgtttgaggatattttcgatgtgaaggatattgacccggagggcaag
aagtttgaccgagtgtctcgactgcattgtgagagtgaatctttcaagatggatctaatc
ttagatgtaaacattcaaatttaccctgtagacttgggtgacaagtttcggttggtcata
gctagtaccttgtatgaagatggtaccctggatgatggtgaatacaaccccactgatgat
aggccttccagggctgaccagtttgagtatgtaatgtatggaaaagtgtacaggattgag
ggagatgaaacttctactgaagcagcaacacgcctctctgcgtacgtgtcctatgggggc
ctgctcatgaggctgcagggggatgccaacaacctgcatggattcgaggtggactccaga
gtttatctcctgatgaagaagctagccttctga

KEGG   Homo sapiens (human): 5438Help
Entry
5438              CDS       T01001                                 

Gene name
POLR2I, RPB9, hRPB14.5
Definition
(RefSeq) RNA polymerase II subunit I
  KO
K03017  DNA-directed RNA polymerase II subunit RPB9
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5438 (POLR2I)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5438 (POLR2I)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5438 (POLR2I)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5438 (POLR2I)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     5438 (POLR2I)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5438 (POLR2I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_POL_M_15KD TFIIS_C Zn_ribbon_recom DZR Ogr_Delta DUF3716 TF_Zn_Ribbon CpXC
Motif
Other DBs
NCBI-GeneID: 5438
NCBI-ProteinID: NP_006224
OMIM: 180662
HGNC: 9196
Ensembl: ENSG00000105258
Vega: OTTHUMG00000181749
Pharos: P36954(Tbio)
UniProt: P36954
Structure
PDB: 

Position
19q13.12
AA seq 125 aa AA seqDB search
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgacgggacttacgagccgggcttcgtgggtattcgcttctgccaggaatgt
aacaacatgctgtaccccaaggaagacaaggagaaccgcattctgctctacgcgtgccgg
aactgtgattaccagcaggaggccgacaacagctgcatctatgtcaacaagatcacgcac
gaagtggacgaactgacccagattatcgccgacgtgtcccaggaccccacgttgccgcgg
accgaggaccacccgtgccaaaagtgcggccacaaggaggctgtgttcttccagtcacac
agtgcgcgggccgaggacgccatgcgcctttactacgtgtgcacagccccacactgcggc
caccgctggaccgagtga

KEGG   Homo sapiens (human): 5439Help
Entry
5439              CDS       T01001                                 

Gene name
POLR2J, POLR2J1, RPB11, RPB11A, RPB11m, hRPB14
Definition
(RefSeq) RNA polymerase II subunit J
  KO
K03008  DNA-directed RNA polymerase II subunit RPB11
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5439 (POLR2J)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5439 (POLR2J)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5439 (POLR2J)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5439 (POLR2J)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     5439 (POLR2J)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5439 (POLR2J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_L_2 RNA_pol_L
Motif
Other DBs
NCBI-GeneID: 5439
NCBI-ProteinID: NP_006225
OMIM: 604150
HGNC: 9197
Ensembl: ENSG00000005075
Vega: OTTHUMG00000150387
Pharos: P52435(Tbio)
UniProt: P52435
Structure
PDB: 

Position
7q22.1
AA seq 117 aa AA seqDB search
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccctccagccttcgagtcgttcttgctcttcgagggcgagaagaagatcacc
attaacaaggacaccaaggtacccaatgcctgtttattcaccatcaacaaagaagaccac
acactgggaaacatcattaaatcacaactcctaaaagacccgcaagtgctatttgctggc
tacaaagtcccccaccccttggagcacaagatcatcatccgagtgcagaccacgccggac
tacagcccccaggaagcctttaccaacgccatcaccgacctcatcagtgagctgtccctg
ctggaggagcgctttcgggtggccataaaagacaagcaggaaggaattgagtag

KEGG   Homo sapiens (human): 5440Help
Entry
5440              CDS       T01001                                 

Gene name
POLR2K, ABC10-alpha, RPABC4, RPB10alpha, RPB12, RPB7.0, hRPB7.0, hsRPB10a
Definition
(RefSeq) RNA polymerase II subunit K
  KO
K03009  DNA-directed RNA polymerases I, II, and III subunit RPABC4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5440 (POLR2K)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    5440 (POLR2K)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5440 (POLR2K)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5440 (POLR2K)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5440 (POLR2K)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     5440 (POLR2K)
  RNA polymerase III system
   RNA polymerase III
     5440 (POLR2K)
  RNA polymerase I system
   RNA polymerase I
     5440 (POLR2K)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5440 (POLR2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_RNApol_7kD A2L_zn_ribbon Cytochrome_C7 HypA MCM_OB DZR zinc_ribbon_13
Motif
Other DBs
NCBI-GeneID: 5440
NCBI-ProteinID: NP_005025
OMIM: 606033
HGNC: 9198
Ensembl: ENSG00000147669
Vega: OTTHUMG00000164705
Pharos: P53803(Tbio)
UniProt: P53803 A0A024R9G0
Structure
PDB: 

Position
8q22.2
AA seq 58 aa AA seqDB search
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atggacacccagaaggacgttcaacctccaaagcagcaaccaatgatatatatctgtgga
gagtgtcacacagaaaatgaaataaaatctagggatccaatcagatgcagagaatgtgga
tacagaataatgtacaagaaaaggactaaaagattggtcgtttttgatgctcgatga

KEGG   Homo sapiens (human): 5441Help
Entry
5441              CDS       T01001                                 

Gene name
POLR2L, RBP10, RPABC5, RPB10, RPB10beta, RPB7.6, hRPB7.6
Definition
(RefSeq) RNA polymerase II subunit L
  KO
K03007  DNA-directed RNA polymerases I, II, and III subunit RPABC5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5441 (POLR2L)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    5441 (POLR2L)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5441 (POLR2L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5441 (POLR2L)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5441 (POLR2L)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     5441 (POLR2L)
  RNA polymerase III system
   RNA polymerase III
     5441 (POLR2L)
  RNA polymerase I system
   RNA polymerase I
     5441 (POLR2L)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5441 (POLR2L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_N
Motif
Other DBs
NCBI-GeneID: 5441
NCBI-ProteinID: NP_066951
OMIM: 601189
HGNC: 9199
Ensembl: ENSG00000177700
Vega: OTTHUMG00000133316
Pharos: P62875(Tbio)
UniProt: P62875
Structure
PDB: 

Position
11p15.5
AA seq 67 aa AA seqDB search
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgatcatccctgtacgctgcttcacttgtggcaagatcgtcggcaacaagtgggaggct
tacctggggctgctgcaggccgagtacaccgagggggatgcgctggatgccctgggcctg
aagcgctactgctgccgccggatgctgctggcccacgtggacctgatcgagaagctgctc
aattatgcacccctggagaagtga

KEGG   Homo sapiens (human): 548644Help
Entry
548644            CDS       T01001                                 

Gene name
POLR2J3, POLR2J2, RPB11b1, RPB11b2
Definition
(RefSeq) RNA polymerase II subunit J3
  KO
K03008  DNA-directed RNA polymerase II subunit RPB11
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    548644 (POLR2J3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    548644 (POLR2J3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    548644 (POLR2J3)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    548644 (POLR2J3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     548644 (POLR2J3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      548644 (POLR2J3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_L_2 RNA_pol_L
Motif
Other DBs
NCBI-GeneID: 548644
NCBI-ProteinID: NP_001091084
HGNC: 33853
Ensembl: ENSG00000168255
Vega: OTTHUMG00000150384
Pharos: Q9GZM3(Tdark)
UniProt: Q9GZM3 A0A0B4J2F8
Position
7q22.1
AA seq 115 aa AA seqDB search
MNAPPAFESFLLFEGEKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGY
KVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccctccagccttcgagtcgttcttgctcttcgagggcgagaagatcaccatt
aacaaggacaccaaggtacccaatgcctgtttattcaccatcaacaaagaagaccacaca
ctgggaaacatcattaaatcacaactcctaaaagacccgcaagtgctatttgctggctac
aaagtcccccaccccttggagcacaagatcatcatccgagtgcagaccacgccggactac
agcccccaggaagcctttaccaacgccatcaccgacctcatcagtgagctgtccctgctg
gaggagcgcttccggacgtgcctgcttccccttcgccttctgccgtga

DBGET integrated database retrieval system