KEGG   Homo sapiens (human): 246778Help
Entry
246778            CDS       T01001                                 

Gene name
IL27, IL-27, IL-27A, IL27A, IL27p28, IL30, p28
Definition
(RefSeq) interleukin 27
  KO
K22629  interleukin 27
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    246778 (IL27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    246778 (IL27)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   246778 (IL27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 246778
NCBI-ProteinID: NP_663634
OMIM: 608273
HGNC: 19157
Ensembl: ENSG00000197272
Vega: OTTHUMG00000097023
Pharos: Q8NEV9(Tbio)
UniProt: Q8NEV9
Position
16p12.1-p11.2
AA seq 243 aa AA seqDB search
MGQTAGDLGWRLSLLLLPLLLVQAGVWGFPRPPGRPQLSLQELRREFTVSLHLARKLLSE
VRGQAHRFAESHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALL
GGLGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGL
LPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLS
PQP
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgggccagacggcaggcgaccttggctggcggctcagcctgttgctgcttcccttgctc
ctggttcaagctggtgtctggggattcccaaggcccccagggaggccccagctgagcctg
caggagctgcggagggagttcacagtcagcctgcatctcgccaggaagctgctctccgag
gttcggggccaggcccaccgctttgcggaatctcacctgccaggagtgaacctgtacctc
ctgcccctgggagagcagctccctgatgtttccctgaccttccaggcctggcgccgcctc
tctgacccggagcgtctctgcttcatctccaccacgcttcagcccttccatgccctgctg
ggagggctggggacccagggccgctggaccaacatggagaggatgcagctgtgggccatg
aggctggacctccgcgatctgcagcggcacctccgcttccaggtgctggctgcaggattc
aacctcccggaggaggaggaggaggaagaggaggaggaggaggaggagaggaaggggctg
ctcccaggggcactgggcagcgccttacagggcccggcccaggtgtcctggccccagctc
ctctccacctaccgcctgctgcactccttggagctcgtcttatctcgggccgtgcgggag
ttgctgctgctgtccaaggctgggcactcagtctggcccttggggttcccaacattgagc
ccccagccctga

DBGET integrated database retrieval system