KEGG   Homo sapiens (human): 248Help
Entry
248               CDS       T01001                                 

Gene name
ALPI, IAP
Definition
(RefSeq) alkaline phosphatase, intestinal
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00730  Thiamine metabolism
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    248 (ALPI)
   00790 Folate biosynthesis
    248 (ALPI)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     248 (ALPI)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   248 (ALPI)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  248 (ALPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 248
NCBI-ProteinID: NP_001622
OMIM: 171740
HGNC: 437
Ensembl: ENSG00000163295
Vega: OTTHUMG00000133258
Pharos: P09923(Tbio)
UniProt: P09923 A0A024R4A2
Position
2q37.1
AA seq 528 aa AA seqDB search
MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLG
DGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLC
GVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYA
HTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADA
SQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRD
PTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERA
GQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF
NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHV
MAFAACLEPYTACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggccctgggtgctgctgctgctgggcctgaggctacagctctccctgggcgtc
atcccagctgaggaggagaacccggccttctggaaccgccaggcagctgaggccctggat
gctgccaagaagctgcagcccatccagaaggtcgccaagaacctcatcctcttcctgggc
gatgggttgggggtgcccacggtgacagccaccaggatcctaaaggggcagaagaatggc
aaactggggcctgagacgcccctggccatggaccgcttcccatacctggctctgtccaag
acatacaatgtggacagacaggtgccagacagcgcagccacagccacggcctacctgtgc
ggggtcaaggccaacttccagaccatcggcttgagtgcagccgcccgctttaaccagtgc
aacacgacacgcggcaatgaggtcatctccgtgatgaaccgggccaagcaagcaggaaag
tcagtaggagtggtgaccaccacacgggtgcagcacgcctcgccagccggcacctacgca
cacacagtgaaccgcaactggtactcagatgctgacatgcctgcctcagcccgccaggag
gggtgccaggacatcgccactcagctcatctccaacatggacattgacgtgatccttggc
ggaggccgcaagtacatgtttcccatggggaccccagaccctgagtacccagctgatgcc
agccagaatggaatcaggctggacgggaagaacctggtgcaggaatggctggcaaagcac
cagggtgcctggtatgtgtggaaccgcactgagctcatgcaggcgtccctggaccagtct
gtgacccatctcatgggcctctttgagcccggagacacgaaatatgagatccaccgagac
cccacactggacccctccctgatggagatgacagaggctgccctgcgcctgctgagcagg
aacccccgcggcttctacctctttgtggagggcggccgcatcgaccatggtcatcatgag
ggtgtggcttaccaggcactcactgaggcggtcatgttcgacgacgccattgagagggcg
ggccagctcaccagcgaggaggacacgctgaccctcgtcaccgctgaccactcccatgtc
ttctcctttggtggctacaccttgcgagggagctccatcttcgggttggcccccagcaag
gctcaggacagcaaagcctacacgtccatcctgtacggcaatggcccgggctacgtgttc
aactcaggcgtgcgaccagacgtgaatgagagcgagagcgggagccccgattaccagcag
caggcggcggtgcccctgtcgtccgagacccacggaggcgaagacgtggcggtgtttgcg
cgcggcccgcaggcgcacctggtgcatggtgtgcaggagcagagcttcgtagcgcatgtc
atggccttcgctgcctgtctggagccctacacggcctgcgacctggcgcctcccgcctgc
accaccgacgccgcgcacccagttgccgcgtcgctgccactgctggccgggaccctgctg
ctgctgggggcgtccgctgctccctga

DBGET integrated database retrieval system