KEGG   Homo sapiens (human): 2492Help
Entry
2492              CDS       T01001                                 

Gene name
FSHR, FSHR1, FSHRO, LGR1, ODG1
Definition
(RefSeq) follicle stimulating hormone receptor
  KO
K04247  follicle stimulating hormone receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04913  Ovarian steroidogenesis
Disease
H00599  46,XX gonadal dysgenesis
H00627  Premature ovarian failure
H01039  Ovarian hyperstimulation syndrome
Drug target
Chorionic gonadotrophin: D06457
Combinations: D06400
Corifollitropin alfa: D08895
Follitropin alfa: D04429
Follitropin beta: D04430
Human menopausal gonadotrophin (DG00472): D02692 D06459
Serum gonadotrophin: D05258
Urofollitropin: D06269
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2492 (FSHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2492 (FSHR)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    2492 (FSHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2492 (FSHR)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Follicle stimulating hormone (FSH)
    2492 (FSHR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 GnHR_trans LRR_8 LRR_5 LRRNT LRR_4 LRR_9
Motif
Other DBs
NCBI-GeneID: 2492
NCBI-ProteinID: NP_000136
OMIM: 136435
HGNC: 3969
Ensembl: ENSG00000170820
Vega: OTTHUMG00000129259
Pharos: P23945(Tclin)
UniProt: P23945 A0A1D5RMN4
Structure
PDB: 

Position
2p16.3
AA seq 695 aa AA seqDB search
MALLLVSLLAFLSLGSGCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRV
IQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP
NLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKN
GIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLEN
LKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQE
VDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIM
GYNILRVLIWFISILAITGNIIVLVILTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIAS
VDIHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLDCK
VQLRHAASVMVMGWIFAFAAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVL
AFVVICGCYIHIYLTVRNPNIVSSSSDTRIAKRMAMLIFTDFLCMAPISFFAISASLKVP
LITVSKAKILLVLFHPINSCANPFLYAIFTKNFRRDFFILLSKCGCYEMQAQIYRTETSS
TVHNTHPRNGHCSSAPRVTSGSTYILVPLSHLAQN
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctcctggtctctttgctggcattcctgagcttgggctcaggatgtcatcat
cggatctgtcactgctctaacagggtttttctctgccaagagagcaaggtgacagagatt
ccttctgacctcccgaggaatgccattgaactgaggtttgtcctcaccaagcttcgagtc
atccaaaaaggtgcattttcaggatttggggacctggagaaaatagagatctctcagaat
gatgtcttggaggtgatagaggcagatgtgttctccaaccttcccaaattacatgaaatt
agaattgaaaaggccaacaacctgctctacatcaaccctgaggccttccagaaccttccc
aaccttcaatatctgttaatatccaacacaggtattaagcaccttccagatgttcacaag
attcattctctccaaaaagttttacttgacattcaagataacataaacatccacacaatt
gaaagaaattctttcgtggggctgagctttgaaagtgtgattctatggctgaataagaat
gggattcaagaaatacacaactgtgcattcaatggaacccaactagatgagctgaatcta
agcgataataataatttagaagaattgcctaatgatgttttccacggagcctctggacca
gtcattctagatatttcaagaacaaggatccattccctgcctagctatggcttagaaaat
cttaagaagctgagggccaggtcgacttacaacttaaaaaagctgcctactctggaaaag
cttgtcgccctcatggaagccagcctcacctatcccagccattgctgtgcctttgcaaac
tggagacggcaaatctctgagcttcatccaatttgcaacaaatctattttaaggcaagaa
gttgattatatgactcaggctaggggtcagagatcctctctggcagaagacaatgagtcc
agctacagcagaggatttgacatgacgtacactgagtttgactatgacttatgcaatgaa
gtggttgacgtgacctgctcccctaagccagatgcattcaacccatgtgaagatatcatg
gggtacaacatcctcagagtcctgatatggtttatcagcatcctggccatcactgggaac
atcatagtgctagtgatcctaactaccagccaatataaactcacagtccccaggttcctt
atgtgcaacctggcctttgctgatctctgcattggaatctacctgctgctcattgcatca
gttgatatccataccaagagccaatatcacaactatgccattgactggcaaactggggca
ggctgtgatgctgctggctttttcactgtctttgccagtgagctgtcagtctacactctg
acagctatcaccttggaaagatggcataccatcacgcatgccatgcagctggactgcaag
gtgcagctccgccatgctgccagtgtcatggtgatgggctggatttttgcttttgcagct
gccctctttcccatctttggcatcagcagctacatgaaggtgagcatctgcctgcccatg
gatattgacagccctttgtcacagctgtatgtcatgtccctccttgtgctcaatgtcctg
gcctttgtggtcatctgtggctgctatatccacatctacctcacagtgcggaaccccaac
atcgtgtcctcctctagtgacaccaggatcgccaagcgcatggccatgctcatcttcact
gacttcctctgcatggcacccatttctttctttgccatttctgcctccctcaaggtgccc
ctcatcactgtgtccaaagcaaagattctgctggttctgtttcaccccatcaactcctgt
gccaaccccttcctctatgccatctttaccaaaaactttcgcagagatttcttcattctg
ctgagcaagtgtggctgctatgaaatgcaagcccaaatttataggacagaaacttcatcc
actgtccacaacacccatccaaggaatggccactgctcttcagctcccagagtcaccagt
ggttccacttacatacttgtccctctaagtcatttagcccaaaactaa

DBGET integrated database retrieval system