KEGG   Homo sapiens (human): 2495Help
Entry
2495              CDS       T01001                                 

Gene name
FTH1, FHC, FTH, FTHL6, HFE5, PIG15, PLIF
Definition
(RefSeq) ferritin heavy chain 1
  KO
K00522  ferritin heavy chain [EC:1.16.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04216  Ferroptosis
hsa04217  Necroptosis
hsa04978  Mineral absorption
Disease
H00211  Hemochromatosis (HFE)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    2495 (FTH1)
   04217 Necroptosis
    2495 (FTH1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    2495 (FTH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2495 (FTH1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.3  With oxygen as acceptor
    1.16.3.2  bacterial non-heme ferritin
     2495 (FTH1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2495 (FTH1)
  Exosomal proteins of bladder cancer cells
   2495 (FTH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ferritin Rubrerythrin
Motif
Other DBs
NCBI-GeneID: 2495
NCBI-ProteinID: NP_002023
OMIM: 134770
HGNC: 3976
Ensembl: ENSG00000167996
Vega: OTTHUMG00000166217
Pharos: P02794(Tbio)
UniProt: P02794 A0A024R525
Structure
PDB: 

Position
11q12.3
AA seq 183 aa AA seqDB search
MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQS
HEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHK
LATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSD
NES
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgcgtccacctcgcaggtgcgccagaactaccaccaggactcagaggccgcc
atcaaccgccagatcaacctggagctctacgcctcctacgtttacctgtccatgtcttac
tactttgaccgcgatgatgtggctttgaagaactttgccaaatactttcttcaccaatct
catgaggagagggaacatgctgagaaactgatgaagctgcagaaccaacgaggtggccga
atcttccttcaggatatcaagaaaccagactgtgatgactgggagagcgggctgaatgca
atggagtgtgcattacatttggaaaaaaatgtgaatcagtcactactggaactgcacaaa
ctggccactgacaaaaatgacccccatttgtgtgacttcattgagacacattacctgaat
gagcaggtgaaagccatcaaagaattgggtgaccacgtgaccaacttgcgcaagatggga
gcgcccgaatctggcttggcggaatatctctttgacaagcacaccctgggagacagtgat
aatgaaagctaa

DBGET integrated database retrieval system