KEGG   Homo sapiens (human): 250Help
Entry
250               CDS       T01001                                 

Gene name
ALPP, ALP, ALPI, IAP, PALP, PLAP, PLAP-1
Definition
(RefSeq) alkaline phosphatase, placental
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00730  Thiamine metabolism
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    250 (ALPP)
   00790 Folate biosynthesis
    250 (ALPP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     250 (ALPP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   250 (ALPP)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  250 (ALPP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 250
NCBI-ProteinID: NP_001623
OMIM: 171800
HGNC: 439
Ensembl: ENSG00000163283
Vega: OTTHUMG00000133255
Pharos: P05187(Tbio)
UniProt: P05187 B2R7C7
Structure
PDB: 

Position
2q37.1
AA seq 535 aa AA seqDB search
MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLII
FLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATA
YLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAG
TYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYP
DDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEI
HRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAI
ERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPG
YVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFI
AHVMAFAACLEPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctggggccctgcatgctgctgctgctgctgctgctgggcctgaggctacagctctcc
ctgggcatcatcccagttgaggaggagaacccggacttctggaaccgcgaggcagccgag
gccctgggtgccgccaagaagctgcagcctgcacagacagccgccaagaacctcatcatc
ttcctgggcgatgggatgggggtgtctacggtgacagctgccaggatcctaaaagggcag
aagaaggacaaactggggcctgagatacccctggccatggaccgcttcccatatgtggct
ctgtccaagacatacaatgtagacaaacatgtgccagacagtggagccacagccacggcc
tacctgtgcggggtcaagggcaacttccagaccattggcttgagtgcagccgcccgcttt
aaccagtgcaacacgacacgcggcaacgaggtcatctccgtgatgaatcgggccaagaaa
gcagggaagtcagtgggagtggtaaccaccacacgagtgcagcacgcctcgccagccggc
acctacgcccacacggtgaaccgcaactggtactcggacgccgacgtgcctgcctccgcc
cgccaggaggggtgccaggacatcgctacgcagctcatctccaacatggacattgacgtg
atcctaggtggaggccgaaagtacatgtttcgcatgggaaccccagaccctgagtaccca
gatgactacagccaaggtgggaccaggctggacgggaagaatctggtgcaggaatggctg
gcgaagcgccagggtgcccggtatgtgtggaaccgcactgagctcatgcaggcttccctg
gacccgtctgtgacccatctcatgggtctctttgagcctggagacatgaaatacgagatc
caccgagactccacactggacccctccctgatggagatgacagaggctgccctgcgcctg
ctgagcaggaacccccgcggcttcttcctcttcgtggagggtggtcgcatcgaccatggt
catcatgaaagcagggcttaccgggcactgactgagacgatcatgttcgacgacgccatt
gagagggcgggccagctcaccagcgaggaggacacgctgagcctcgtcactgccgaccac
tcccacgtcttctccttcggaggctaccccctgcgagggagctccatcttcgggctggcc
cctggcaaggcccgggacaggaaggcctacacggtcctcctatacggaaacggtccaggc
tatgtgctcaaggacggcgcccggccggatgttaccgagagcgagagcgggagccccgag
tatcggcagcagtcagcagtgcccctggacgaagagacccacgcaggcgaggacgtggcg
gtgttcgcgcgcggcccgcaggcgcacctggttcacggcgtgcaggagcagaccttcata
gcgcacgtcatggccttcgccgcctgcctggagccctacaccgcctgcgacctggcgccc
cccgccggcaccaccgacgccgcgcacccggggcggtccgtggtccccgcgttgcttcct
ctgctggccgggaccctgctgctgctggagacggccactgctccctga

DBGET integrated database retrieval system