KEGG   Homo sapiens (human): 251Help
Entry
251               CDS       T01001                                 

Gene name
ALPG, ALPPL, ALPPL2, GCAP
Definition
(RefSeq) alkaline phosphatase, germ cell
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00730  Thiamine metabolism
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    251 (ALPG)
   00790 Folate biosynthesis
    251 (ALPG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    251 (ALPG)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    251 (ALPG)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     251 (ALPG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   251 (ALPG)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  251 (ALPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-GeneID: 251
NCBI-ProteinID: NP_112603
OMIM: 171810
HGNC: 441
Ensembl: ENSG00000163286
Vega: OTTHUMG00000133257
Pharos: P10696(Tchem)
UniProt: P10696
Position
2q37.1
AA seq 532 aa AA seqDB search
MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLG
DGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLC
GVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDY
SQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPSVTHLMGLFEPGDMKYEIHRD
STLDPSLMEMTEAALLLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERA
GQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL
KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV
MAFAACLEPYTACDLAPRAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggccctgggtgctgctcctgctgggcctgaggctacagctctccctgggcatc
atcccagttgaggaggagaacccggacttctggaaccgccaggcagccgaggccctgggt
gccgccaagaagctgcagcctgcacagacagccgccaagaacctcatcatcttcctgggt
gacgggatgggggtgtctacggtgacagctgccaggatcctaaaagggcagaagaaggac
aaactggggcctgagaccttcctggccatggaccgcttcccgtacgtggctctgtccaag
acatacagtgtagacaagcatgtgccagacagtggagccacagccacggcctacctgtgc
ggggtcaagggcaacttccagaccattggcttgagtgcagccgcccgctttaaccagtgc
aacacgacacgcggcaacgaggtcatctccgtgatgaatcgggccaagaaagcaggaaag
tcagtgggagtggtaaccaccacacgggtgcagcatgcctcgccagccggcgcctacgcc
cacacggtgaaccgcaactggtactcggatgccgacgtgcctgcctcggcccgccaggag
gggtgccaggacatcgccacgcagctcatctccaacatggacattgatgtgatcctaggt
ggaggccgaaagtacatgtttcccatggggaccccagaccctgagtacccagatgactac
agccaaggtgggaccaggctggacgggaagaatctggtgcaggaatggctggcgaagcac
cagggtgcccggtacgtgtggaaccgcactgagctcctgcaggcttccctggacccgtct
gtgacccatctcatgggtctctttgagcctggagacatgaaatacgagatccaccgagac
tccacactggacccctccctgatggagatgacagaggctgccctgctcctgctgagcagg
aacccccgcggcttcttcctcttcgtggagggtggtcgcatcgaccatggtcatcatgaa
agcagggcttaccgggcactgactgagacgatcatgttcgacgacgccattgagagggcg
ggccagctcaccagcgaggaggacacgctgagcctcgtcactgccgaccactcccacgtc
ttctccttcggaggctaccccctgcgagggagctccatcttcgggctggcccctggcaag
gcccgggacaggaaggcctacacggtcctcctatacggaaacggtccaggctatgtgctc
aaggacggcgcccggccggatgttacggagagcgagagcgggagccccgagtatcggcag
cagtcagcagtgcccctggacggagagacccacgcaggcgaggacgtggcggtgttcgcg
cgcggcccgcaggcgcacctggttcacggcgtgcaggagcagaccttcatagcgcacgtc
atggccttcgccgcctgcctggagccctacaccgcctgcgacctggcgccccgcgccggc
accaccgacgccgcgcacccggggccgtccgtggtccccgcgttgcttcctctgctggca
gggaccttgctgctgctggggacggccactgctccctga

DBGET integrated database retrieval system