KEGG   Homo sapiens (human): 2515Help
Entry
2515              CDS       T01001                                 

Gene name
ADAM2, CRYN1, CRYN2, CT15, FTNB, PH-30b, PH30, PH30-beta
Definition
(RefSeq) ADAM metallopeptidase domain 2
  KO
K06833  disintegrin and metalloproteinase domain-containing protein 2 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    2515 (ADAM2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     2515 (ADAM2)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   2515 (ADAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin ADAM_CR Pep_M12B_propep Disintegrin Reprolysin_5
Motif
Other DBs
NCBI-GeneID: 2515
NCBI-ProteinID: NP_001455
OMIM: 601533
HGNC: 198
Ensembl: ENSG00000104755
Vega: OTTHUMG00000164041
Pharos: Q99965(Tbio)
UniProt: Q99965
Position
8p11.22
AA seq 735 aa AA seqDB search
MWRVLFLLSGLGGLRMDSNFDSLPVQITVPEKIRSIIKEGIESQASYKIVIEGKPYTVNL
MQKNFLPHNFRVYSYSGTGIMKPLDQDFQNFCHYQGYIEGYPKSVVMVSTCTGLRGVLQF
ENVSYGIEPLESSVGFEHVIYQVKHKKADVSLYNEKDIESRDLSFKLQSVEPQQDFAKYI
EMHVIVEKQLYNHMGSDTTVVAQKVFQLIGLTNAIFVSFNITIILSSLELWIDENKIATT
GEANELLHTFLRWKTSYLVLRPHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPR
TISLESLAVILAQLLSLSMGITYDDINKCQCSGAVCIMNPEAIHFSGVKIFSNCSFEDFA
HFISKQKSQCLHNQPRLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATCR
FKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGHPCGLN
QWICIDGVCMSGDKQCTDTFGKEVEFGPSECYSHLNSKTDVSGNCGISDSGYTQCEADNL
QCGKLICKYVGKFLLQIPRATIIYANISGHLCIAVEFASDHADSQKMWIKDGTSCGSNKV
CRNQRCVSSSYLGYDCTTDKCNDRGVCNNKKHCHCSASYLPPDCSVQSDLWPGGSIDSGN
FPPVAIPARLPERRYIENIYHSKPMRWPFFLFIPFFIIFCVLIAIMVKVNFQRKKWRTED
YSSDEQPESESEPKG
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgtcttgtttctgctcagcgggctcggcgggctgcggatggacagtaatttt
gatagtttacctgtgcaaattacagttccggagaaaatacggtcaataataaaggaagga
attgaatcgcaggcatcctacaaaattgtaattgaagggaaaccatatactgtgaattta
atgcaaaaaaactttttaccccataattttagagtttacagttatagtggcacaggaatt
atgaaaccacttgaccaagattttcagaatttctgccactaccaagggtatattgaaggt
tatccaaaatctgtggtgatggttagcacatgtactggactcaggggcgtactacagttt
gaaaatgttagttatggaatagaacccctggagtcttcagttggctttgaacatgtaatt
taccaagtaaaacataagaaagcagatgtttccttatataatgagaaggatattgaatca
agagatctgtcctttaaattacaaagcgtagagccacagcaagattttgcaaagtatata
gaaatgcatgttatagttgaaaaacaattgtataatcatatggggtctgatacaactgtt
gtcgctcaaaaagttttccagttgattggattgacgaatgctatttttgtttcatttaat
attacaattattctgtcttcattggagctttggatagatgaaaataaaattgcaaccact
ggagaagctaatgagttattacacacatttttaagatggaaaacatcttatcttgtttta
cgtcctcatgatgtggcatttttacttgtttacagagaaaagtcaaattatgttggtgca
acctttcaagggaagatgtgtgatgcaaactatgcaggaggtgttgttctgcaccccaga
accataagtctggaatcacttgcagttattttagctcaattattgagccttagtatgggg
atcacttatgatgacattaacaaatgccagtgctcaggagctgtctgcattatgaatcca
gaagcaattcatttcagtggtgtgaagatctttagtaactgcagcttcgaagactttgca
cattttatttcaaagcagaagtcccagtgtcttcacaatcagcctcgcttagatcctttt
ttcaaacagcaagcagtgtgtggtaatgcaaagctggaagcaggagaggagtgtgactgt
gggactgaacaggattgtgcccttattggagaaacatgctgtgatattgccacatgtaga
tttaaagccggttcaaactgtgctgaaggaccatgctgcgaaaactgtctatttatgtca
aaagaaagaatgtgtaggccttcctttgaagaatgcgacctccctgaatattgcaatgga
tcatctgcatcatgcccagaaaaccactatgttcagactgggcatccgtgtggactgaat
caatggatctgtatagatggagtttgtatgagtggggataaacaatgtacagacacattt
ggcaaagaagtagagtttggcccttcagaatgttattctcaccttaattcaaagactgat
gtatctggaaactgtggtataagtgattcaggatacacacagtgtgaagctgacaatctg
cagtgcggaaaattaatatgtaaatatgtaggtaaatttttattacaaattccaagagcc
actattatttatgccaacataagtggacatctctgcattgctgtggaatttgccagtgat
catgcagacagccaaaagatgtggataaaagatggaacttcttgtggttcaaataaggtt
tgcaggaatcaaagatgtgtgagttcttcatacttgggttatgattgtactactgacaaa
tgcaatgatagaggtgtatgcaataacaaaaagcactgtcactgtagtgcttcatattta
cctccagattgctcagttcaatcagatctatggcctggtgggagtattgacagtggcaat
tttccacctgtagctataccagccagactccctgaaaggcgctacattgagaacatttac
cattccaaaccaatgagatggccatttttcttattcattcctttctttattattttctgt
gtactgattgctataatggtgaaagttaatttccaaaggaaaaaatggagaactgaggac
tattcaagcgatgagcaacctgaaagtgagagtgaacctaaagggtag

DBGET integrated database retrieval system