KEGG   Homo sapiens (human): 2517Help
Entry
2517              CDS       T01001                                 

Gene name
FUCA1, FUCA
Definition
(RefSeq) alpha-L-fucosidase 1
  KO
K01206  alpha-L-fucosidase [EC:3.2.1.51]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00511  Other glycan degradation
hsa04142  Lysosome
Disease
H00141  Fucosidosis
H00422  Glycoproteinoses
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    2517 (FUCA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    2517 (FUCA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2517 (FUCA1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.51  alpha-L-fucosidase
     2517 (FUCA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2517 (FUCA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha_L_fucos Fucosidase_C GHL6
Motif
Other DBs
NCBI-GeneID: 2517
NCBI-ProteinID: NP_000138
OMIM: 612280
HGNC: 4006
Ensembl: ENSG00000179163
Vega: OTTHUMG00000002965
Pharos: P04066(Tchem)
UniProt: P04066
Position
1p36.11
AA seq 466 aa AA seqDB search
MRAPGMRSRPAGPALLLLLLFLGAAESVRRAQPPRRYTPDWPSLDSRPLPAWFDEAKFGV
FIHWGVFSVPAWGSEWFWWHWQGEGRPQYQRFMRDNYPPGFSYADFGPQFTARFFHPEEW
ADLFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYG
LYHSLLEWFHPLYLLDKKNGFKTQHFVSAKTMPELYDLVNSYKPDLIWSDGEWECPDTYW
NSTNFLSWLYNDSPVKDEVVVNDRWGQNCSCHHGGYYNCEDKFKPQSLPDHKWEMCTSID
KFSWGYRRDMALSDVTEESEIISELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGK
WLSINGEAIYASKPWRVQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTK
ITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcgggctccggggatgaggtcgcggccggcgggtcccgcgctgttgctgctgctgctc
ttcctcggagcggccgagtcggtgcgtcgggcccagcctccgcgccgctacaccccagac
tggccgagcctggattctcggccgctgccggcctggttcgacgaagccaagttcggggtg
ttcatccactggggcgtgttctcggtgcccgcctggggcagcgagtggttctggtggcac
tggcagggcgaggggcggccgcagtaccagcgcttcatgcgcgacaactacccgcccggc
ttcagctacgccgacttcggaccgcagttcactgcgcgcttcttccacccggaggagtgg
gccgacctcttccaggccgcgggcgccaagtatgtagttttgacgacaaagcatcacgaa
ggcttcacaaactggccgagtcctgtgtcttggaactggaactccaaagacgtggggcct
catcgggatttggttggtgaattgggaacagctctccggaagaggaacatccgctatgga
ctataccactcactcttagagtggttccatccactctatctacttgataagaaaaatggc
ttcaaaacacagcattttgtcagtgcaaaaacaatgccagagctgtacgaccttgttaac
agctataaacctgatctgatctggtctgatggggagtgggaatgtcctgatacttactgg
aactccacaaattttctttcatggctctacaatgacagccctgtcaaggatgaggtggta
gtaaatgaccgatggggtcagaactgttcctgtcaccatggaggatactataactgtgaa
gataaattcaagccacagagcttgccagatcacaagtgggagatgtgcaccagcattgac
aagttttcctggggctatcgtcgtgacatggcattgtctgatgttacagaagaatctgaa
atcatttcggaactggttcagacagtaagtttgggaggcaactatcttctgaacattgga
ccaactaaagatggactgattgttcccatcttccaagaaaggcttcttgctgttgggaaa
tggctgagcatcaatggggaggctatctatgcctccaaaccatggcgggtgcaatgggaa
aagaacacaacatctgtatggtatacctcaaagggatcggctgtttatgccatttttctg
cactggccagaaaatggagtcttaaaccttgaatcccccataactacctcaactacaaag
ataacaatgctgggaattcaaggagatctgaagtggtccacagatccagataaaggtctc
ttcatctctctaccccagttgccaccctctgctgtccccgcagagtttgcttggactata
aagctgacaggagtgaagtaa

DBGET integrated database retrieval system