KEGG   Homo sapiens (human): 2519
Entry
2519              CDS       T01001                                 

Gene name
FUCA2, dJ20N2.5
Definition
(RefSeq) alpha-L-fucosidase 2
  KO
K01206  alpha-L-fucosidase [EC:3.2.1.51]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00511  Other glycan degradation
hsa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    2519 (FUCA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    2519 (FUCA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2519 (FUCA2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.51  alpha-L-fucosidase
     2519 (FUCA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2519 (FUCA2)
SSDB
Motif
Pfam: Alpha_L_fucos Fucosidase_C
Other DBs
NCBI-GeneID: 2519
NCBI-ProteinID: NP_114409
OMIM: 136820
HGNC: 4008
Ensembl: ENSG00000001036
Vega: OTTHUMG00000015728
Pharos: Q9BTY2(Tchem)
UniProt: Q9BTY2
Position
6q24.2
AA seq 467 aa
MRPQELPRLAFPLLLLLLLLLPPPPCPAHSATRFDPTWESLDARQLPAWFDQAKFGIFIH
WGVFSVPSFGSEWFWWYWQKEKIPKYVEFMKDNYPPSFKYEDFGPLFTAKFFNANQWADI
FQASGAKYIVLTSKHHEGFTLWGSEYSWNWNAIDEGPKRDIVKELEVAIRNRTDLRFGLY
YSLFEWFHPLFLEDESSSFHKRQFPVSKTLPELYELVNNYQPEVLWSDGDGGAPDQYWNS
TGFLAWLYNESPVRGTVVTNDRWGAGSICKHGGFYTCSDRYNPGHLLPHKWENCMTIDKL
SWGYRREAGISDYLTIEELVKQLVETVSCGGNLLMNIGPTLDGTISVVFEERLRQMGSWL
KVNGEAIYETHTWRSQNDTVTPDVWYTSKPKEKLVYAIFLKWPTSGQLFLGHPKAILGAT
EVKLLGHGQPLNWISLEQNGIMVELPQLTIHQMPCKWGWALALTNVI
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgcggccccaggagctccccaggctcgcgttcccgttgctgctgttgctgttgctgctg
ctgccgccgccgccgtgccctgcccacagcgccacgcgcttcgaccccacctgggagtcc
ctggacgcccgccagctgcccgcgtggtttgaccaggccaagttcggcatcttcatccac
tggggagtgttttccgtgcccagcttcggtagcgagtggttctggtggtattggcaaaag
gaaaagataccgaagtatgtggaatttatgaaagataattaccctcctagtttcaaatat
gaagattttggaccactatttacagcaaaattttttaatgccaaccagtgggcagatatt
tttcaggcctctggtgccaaatacattgtcttaacttccaaacatcatgaaggctttacc
ttgtgggggtcagaatattcgtggaactggaatgccatagatgaggggcccaagagggac
attgtcaaggaacttgaggtagccattaggaacagaactgacctgcgttttggactgtac
tattccctttttgaatggtttcatccgctcttccttgaggatgaatccagttcattccat
aagcggcaatttccagtttctaagacattgccagagctctatgagttagtgaacaactat
cagcctgaggttctgtggtcggatggtgacggaggagcaccggatcaatactggaacagc
acaggcttcttggcctggttatataatgaaagcccagttcggggcacagtagtcaccaat
gatcgttggggagctggtagcatctgtaagcatggtggcttctatacctgcagtgatcgt
tataacccaggacatcttttgccacataaatgggaaaactgcatgacaatagacaaactg
tcctggggctataggagggaagctggaatctctgactatcttacaattgaagaattggtg
aagcaacttgtagagacagtttcatgtggaggaaatcttttgatgaatattgggcccaca
ctagatggcaccatttctgtagtttttgaggagcgactgaggcaaatggggtcctggcta
aaagtcaatggagaagctatttatgaaacccatacctggcgatcccagaatgacactgtc
accccagatgtgtggtacacatccaagcctaaagaaaaattagtctatgccatttttctt
aaatggcccacatcaggacagctgttccttggccatcccaaagctattctgggggcaaca
gaggtgaaactactgggccatggacagccacttaactggatttctttggagcaaaatggc
attatggtagaactgccacagctaaccattcatcagatgccgtgtaaatggggctgggct
ctagccctgactaatgtgatctaa

DBGET integrated database retrieval system