KEGG   Homo sapiens (human): 2524Help
Entry
2524              CDS       T01001                                 

Gene name
FUT2, B12QTL1, SE, SEC2, Se2, sej
Definition
(RefSeq) fucosyltransferase 2
  KO
K00718  galactoside 2-L-fucosyltransferase 1/2 [EC:2.4.1.69]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00601  Glycosphingolipid biosynthesis - lacto and neolacto series
hsa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    2524 (FUT2)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    2524 (FUT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    2524 (FUT2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2524 (FUT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.69  type 1 galactoside alpha-(1,2)-fucosyltransferase
     2524 (FUT2)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  ABO blood group
   2524 (FUT2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Others
   Fucosyltransferase
    2524 (FUT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_11 O-FucT DUF5623
Motif
Other DBs
NCBI-GeneID: 2524
NCBI-ProteinID: NP_000502
OMIM: 182100
HGNC: 4013
Ensembl: ENSG00000176920
Vega: OTTHUMG00000164427
Pharos: Q10981(Tbio)
UniProt: Q10981 A8K2L2
Position
19q13.33
AA seq 343 aa AA seqDB search
MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQL
RGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATAS
RIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQK
FLRGLQVNGSRPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSLIFV
VTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTG
GDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcgttcagatgcctttctcctttcccatggcccacttcatcctctttgtcttt
acggtttccactatatttcacgttcagcagcggctagcgaagattcaagccatgtgggag
ttaccggtgcagataccagtgctagcctcaacatcaaaggcactgggacccagccagctc
agggggatgtggacgatcaatgcaataggccgcctggggaaccagatgggcgagtacgcc
acactgtacgccctggccaagatgaacgggcggcccgccttcatcccggcccagatgcac
agcaccctggcccccatcttcagaatcaccctgccggtgctgcacagcgccacggccagc
aggatcccctggcagaactaccacctgaacgactggatggaggaggaataccgccacatc
ccgggggagtacgtccgcttcaccggctacccctgctcctggaccttctaccaccacctc
cgccaggagatcctccaggagttcaccctgcacgaccacgtgcgggaggaggcccagaag
ttcctgcggggcctgcaggtgaacgggagccggccgggcacctttgtaggggtccatgtt
cgccgaggggactatgtccatgtcatgccaaaagtgtggaagggggtggtggccgaccgg
cgatacctacagcaggccctggactggttccgagctcgctacagctccctcatcttcgtg
gtcaccagtaatggcatggcctggtgtcgggagaacattgacacctcccacggtgatgtg
gtgtttgctggcgatggcattgagggctcacctgccaaagattttgctctactcacacag
tgtaaccacaccatcatgaccattgggacgttcgggatctgggccgcatacctcacgggc
ggagacaccatctacctggccaattacaccctccccgactcccctttcctcaaaatcttt
aagccagaggcagccttcctgccggagtggacagggattgccgcagacctgtccccctta
ctcaagcactaa

DBGET integrated database retrieval system