KEGG   Homo sapiens (human): 252995Help
Entry
252995            CDS       T01001                                 

Gene name
FNDC5, FRCP2, irisin
Definition
(RefSeq) fibronectin type III domain containing 5
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 DUF4808 Sigma_reg_N Interfer-bind
Motif
Other DBs
NCBI-GeneID: 252995
NCBI-ProteinID: NP_715637
OMIM: 611906
HGNC: 20240
Ensembl: ENSG00000160097
Vega: OTTHUMG00000004015
Pharos: Q8NAU1(Tbio)
UniProt: Q8NAU1
Structure
PDB: 

Position
1p35.1
AA seq 212 aa AA seqDB search
MHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDE
VVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPV
LFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIK
DNEPNNNKEKTKSASETSTPEHQGGGLLRSKI
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atacaccccgggtcgccgagcgcctggccgccccgcgcccgcgccgcgctccgcctgtgg
ctgggctgcgtctgcttcgcgctggtgcaggcggacagtccctcagccccagtgaacgtc
accgtcaggcacctcaaggccaactctgcagtggtgagctgggatgttctggaggatgag
gttgtcatcggatttgccatctcccagcagaagaaggatgtgcggatgctgcgcttcatc
caggaggtgaacaccaccacccgctcatgtgccctctgggacctggaggaggatacggag
tacatagtccacgtgcaggccatctccattcagggccagagcccagccagcgagcctgtg
ctcttcaagaccccgcgtgaggctgagaagatggcctccaagaacaaagatgaggtaacc
atgaaagagatggggaggaaccaacagctgcggacaggcgaggtgctgatcatcgtcgtg
gtcctgttcatgtgggcaggtgtcattgccctcttctgccgccagtatgacatcatcaag
gacaatgaacccaataacaacaaggaaaaaaccaagagtgcatcagaaaccagcacacca
gagcaccagggcggggggcttctccgcagcaagatatga

DBGET integrated database retrieval system