KEGG   Homo sapiens (human): 2532
Entry
2532              CDS       T01001                                 

Gene name
ACKR1, CCBP1, CD234, DARC, DARC/ACKR1, Dfy, FY, GPD, GpFy, WBCQ1
Definition
(RefSeq) atypical chemokine receptor 1 (Duffy blood group)
  KO
K06574  atypical chemokine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05144  Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    2532 (ACKR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2532 (ACKR1)
   04050 Cytokine receptors [BR:hsa04050]
    2532 (ACKR1)
   04090 CD molecules [BR:hsa04090]
    2532 (ACKR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    2532 (ACKR1)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   2532 (ACKR1)
CD molecules [BR:hsa04090]
 Proteins
  2532 (ACKR1)
SSDB
Other DBs
NCBI-GeneID: 2532
NCBI-ProteinID: NP_002027
OMIM: 613665
HGNC: 4035
Ensembl: ENSG00000213088
Vega: OTTHUMG00000037182
Pharos: Q16570(Tbio)
UniProt: Q16570 Q5Y7A2
Structure
PDB: 
4NUU 4NUV

Position
1q23.2
AA seq 336 aa
MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDS
ALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGL
GSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALL
TLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPG
PWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVAT
PLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggggaactgtctgcacagggcggagctctccccctcaactgagaactcaagtcagctg
gacttcgaagatgtatggaattcttcctatggtgtgaatgattccttcccagatggagac
tatggtgccaacctggaagcagctgccccctgccactcctgtaacctgctggatgactct
gcactgcccttcttcatcctcaccagtgtcctgggtatcctagctagcagcactgtcctc
ttcatgcttttcagacctctcttccgctggcagctctgccctggctggcctgtcctggca
cagctggctgtgggcagtgccctcttcagcattgtggtgcccgtcttggccccagggcta
ggtagcactcgcagctctgccctgtgtagcctgggctactgtgtctggtatggctcagcc
tttgcccaggctttgctgctagggtgccatgcctccctgggccacagactgggtgcaggc
caggtcccaggcctcaccctggggctcactgtgggaatttggggagtggctgccctactg
acactgcctgtcaccctggccagtggtgcttctggtggactctgcaccctgatatacagc
acggagctgaaggctttgcaggccacacacactgtagcctgtcttgccatctttgtcttg
ttgccattgggtttgtttggagccaaggggctgaagaaggcattgggtatggggccaggc
ccctggatgaatatcctgtgggcctggtttattttctggtggcctcatggggtggttcta
ggactggatttcctggtgaggtccaagctgttgctgttgtcaacatgtctggcccagcag
gctctggacctgctgctgaacctggcagaagccctggcaattttgcactgtgtggctacg
cccctgctcctcgccctattctgccaccaggccacccgcaccctcttgccctctctgccc
ctccctgaaggatggtcttctcatctggacacccttggaagcaaatcctag

DBGET integrated database retrieval system