KEGG   Homo sapiens (human): 2535Help
Entry
2535              CDS       T01001                                 

Gene name
FZD2, Fz2, fz-2, fzE2, hFz2
Definition
(RefSeq) frizzled class receptor 2
  KO
K02235  frizzled 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00677  Wnt signaling
Network
N00056  Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    2535 (FZD2)
   04390 Hippo signaling pathway
    2535 (FZD2)
   04150 mTOR signaling pathway
    2535 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    2535 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    2535 (FZD2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    2535 (FZD2)
   05205 Proteoglycans in cancer
    2535 (FZD2)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    2535 (FZD2)
   05226 Gastric cancer
    2535 (FZD2)
   05217 Basal cell carcinoma
    2535 (FZD2)
   05224 Breast cancer
    2535 (FZD2)
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    2535 (FZD2)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    2535 (FZD2)
   05165 Human papillomavirus infection
    2535 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2535 (FZD2)
G protein-coupled receptors [BR:hsa04030]
 Frizzled / Smoothened family
  2535 (FZD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz DUF5083
Motif
Other DBs
NCBI-GeneID: 2535
NCBI-ProteinID: NP_001457
OMIM: 600667
HGNC: 4040
Ensembl: ENSG00000180340
Vega: OTTHUMG00000181819
Pharos: Q14332(Tbio)
UniProt: Q14332 Q86UZ8
Structure
PDB: 

Position
17q21.31
AA seq 565 aa AA seqDB search
MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNL
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQG
CEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTP
GGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEE
TRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL
QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKW
GHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACY
FYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIW
SGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgcggccccgcagcgccctgccccgcctgctgctgccgctgctgctgctgcccgccgcc
gggccggcccagttccacggggagaagggcatctccatcccggaccacggcttctgccag
cccatctccatcccgctgtgcacggacatcgcctacaaccagaccatcatgcccaacctt
ctgggccacacgaaccaggaggacgcaggcctagaggtgcaccagttctatccgctggtg
aaggtgcagtgctcgcccgaactgcgcttcttcctgtgctccatgtacgcacccgtgtgc
accgtgctggaacaggccatcccgccgtgccgctctatctgtgagcgcgcgcgccagggc
tgcgaagccctcatgaacaagttcggttttcagtggcccgagcgcctgcgctgcgagcac
ttcccgcgccacggcgccgagcagatctgcgtcggccagaaccactccgaggacggagct
cccgcgctactcaccaccgcgccgccgccgggactgcagccgggtgccgggggcaccccg
ggtggcccgggcggcggcggcgctcccccgcgctacgccacgctggagcaccccttccac
tgcccgcgcgtcctcaaggtgccatcctatctcagctacaagtttctgggcgagcgtgat
tgtgctgcgccctgcgaacctgcgcggcccgatggttccatgttcttctcacaggaggag
acgcgtttcgcgcgcctctggatcctcacctggtcggtgctgtgctgcgcttccaccttc
ttcactgtcaccacgtacttggtagacatgcagcgcttccgctacccagagcggcctatc
atttttctgtcgggctgctacaccatggtgtcggtggcctacatcgcgggcttcgtgctc
caggagcgcgtggtgtgcaacgagcgcttctccgaggacggttaccgcacggtggtgcag
ggcaccaagaaggagggctgcaccatcctcttcatgatgctctacttcttcagcatggcc
agctccatctggtgggtcatcctgtcgctcacctggttcctggcagccggcatgaagtgg
ggccacgaggccatcgaggccaactctcagtacttccacctggccgcctgggccgtgccg
gccgtcaagaccatcaccatcctggccatgggccagatcgacggcgacctgctgagcggc
gtgtgcttcgtaggcctcaacagcctggacccgctgcggggcttcgtgctagcgccgctc
ttcgtgtacctgttcatcggcacgtccttcctcctggccggcttcgtgtcgctcttccgc
atccgcaccatcatgaagcacgacggcaccaagaccgaaaagctggagcggctcatggtg
cgcatcggcgtcttctccgtgctctacacagtgcccgccaccatcgtcatcgcttgctac
ttctacgagcaggccttccgcgagcactgggagcgctcgtgggtgagccagcactgcaag
agcctggccatcccgtgcccggcgcactacacgccgcgcatgtcgcccgacttcacggtc
tacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcgggcttctggatctgg
tcgggcaagacgctgcactcgtggaggaagttctacactcgcctcaccaacagccgacac
ggtgagaccaccgtgtga

DBGET integrated database retrieval system