KEGG   Homo sapiens (human): 253512
Entry
253512            CDS       T01001                                 

Gene name
SLC25A30, KMCP1
Definition
(RefSeq) solute carrier family 25 member 30
  KO
K15106  solute carrier family 25 (mitochondrial carrier), member 14/30
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    253512 (SLC25A30)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   253512 (SLC25A30)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 253512
NCBI-ProteinID: NP_001010875
OMIM: 610793
HGNC: 27371
Ensembl: ENSG00000174032
Vega: OTTHUMG00000016853
Pharos: Q5SVS4(Tdark)
UniProt: Q5SVS4 B3KSR0 B3KTE8
Position
13q14.13
AA seq 291 aa
MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIG
REEGLKALYSGIAPAMLRQASYGTIKIGTYQSLKRLFIERPEDETLPINVICGILSGVIS
STIANPTDVLKIRMQAQSNTIQGGMIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVEL
PVYDITKKHLILSGLMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQRVLRDGRCS
GYTGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFVTYEQLKKLDL
NT seq 876 nt   +upstreamnt  +downstreamnt
atgtcagccctcaactggaagccgtttgtgtacggggggctggcctccatcactgctgag
tgcggtacatttccaattgatttaaccaagacacggctccagattcaaggccagacgaat
gatgcaaaatttaaggaaattagataccgaggaatgttgcacgcattagtgaggataggc
agagaagaagggctgaaagcactctactcggggattgcccccgcgatgttacgccaggca
tcctatggcaccatcaagataggcacttaccagagcttgaagcgactattcattgaacgc
ccagaagatgaaactctaccgataaatgtgatatgtggaattctgtctggagtcatatct
tcaaccattgctaatccaactgatgttttgaaaattcggatgcaagcgcaaagcaacacc
attcaaggaggaatgataggcaacttcatgaacatttaccagcaagaggggacaagagga
ctgtggaagggtgtgtcccttactgcgcagagggctgctattgttgttggtgtggagctg
ccggtctatgacatcaccaagaagcatcttattctctcaggcctgatgggagacactgtg
tatacccacttcctctcaagcttcacctgtggtctggcaggggccctggcctcaaaccct
gttgatgttgtgaggacacgtatgatgaatcagagagtgcttcgagatggcagatgttct
ggctacacaggaaccctggattgcttgttacagacatggaagaatgaagggttttttgct
ctctataaaggcttttggccaaattggttgagacttggtccttggaatatcattttcttt
gtgacatacgagcagttgaagaaattggatttgtga

DBGET integrated database retrieval system