KEGG   Homo sapiens (human): 253725Help
Entry
253725            CDS       T01001                                 

Gene name
WASHC2C, FAM21A, FAM21C, VPEF
Definition
(RefSeq) WASH complex subunit 2C
  KO
K18462  WASH complex subunit FAM21
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    253725 (WASHC2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    253725 (WASHC2C)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Others
   WASH complex
    253725 (WASHC2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAP-ZIP_m
Motif
Other DBs
NCBI-GeneID: 253725
NCBI-ProteinID: NP_056077
OMIM: 613631
HGNC: 23414
Ensembl: ENSG00000172661
Vega: OTTHUMG00000018089
Pharos: Q9Y4E1(Tbio)
UniProt: Q9Y4E1 A8K5W5 B3KMC4
Position
10q11.22
AA seq 1320 aa AA seqDB search
MMNRTTPDQELVPASEPVWERPWSVEEIRRSSQSWSLAADAGLLQFLQEFSQQTISRTHE
IKKQVDGLIRETKATDCRLHNVFNDFLMLSNTQFIENRVYDEEVEEPVLKAEAEKTEQEK
TREQKEVDLIPKVQEAVNYGLQVLDSAFEQLDIKAGNSDSEEDDANGRVELILEPKDLYI
DRPLPYLIGSKLFMEQEDVGLGELSSEEGSVGSDRGSIVDTEEEKEEEESDEDFAHHSDN
EQNQHTTQMSDEEEDDDGCDLFADSEKEEEDIEDIEENTRPKRSRPTSFADELAARIKGD
AMGRVDEEPTTLPSGEAKPRKTLKEKKERRTPSDDEEDNLFAPPKLTDEDFSPFGSGGGL
FSGGKGLFDDEDEESDLFTEASQDRQAGASVKEESSSSKPGKKIPAGAVSVFLGDTDVFG
AASVPSLKEPQKPEQPTPRKSPYGPPPTGLFDDDDGDDDDDFFSAPHSKPSKTRKVQSTA
DIFGDEEGDLFKEKAVASPEATVSQTDENKARAEKKVTLSYSKNLKPSSETKTQKGLFSD
EEDSEDLFSSQSASNLKGASLLPGKLPTSVSLFDDEDEEDNLFGGTAAKKQTLSLQAQRE
EKAKASELSKKKASALLFSSDEEDQWNIPASQTHLASDSRSKGEPRDSGTLQSQEAKAVK
KTSLFEEDKEDDLFAIAKDSQKKTQRVSLLFEDDVDSGGSLFGSPPTSVPPATKKKETVS
EAPPLLFSDEEEKEAQLGVKSVDKKVESAKESLKFGRTDVAESEKEGLLTRSAQETVKHS
DLFSSSSPWDKGTKPRTKTVLSLFDEEEDKMEDQNIIQAPQKEVGKGCDPDAHPKSTGVF
QDEELLFSHKLQKDNDPDVDLFAGTKKTKLLEPSVGSLFGDDEDDDLFSSAKSQPLVQEK
KRVVKKDHSVNSFKNQKHPESIQGSKEKGIWKPETPQANLAINPAALLPTAASQISEVKP
VLPELAFPSSEHRRSHGLESVPVLPGSGEAGVSFDLPAQADTLHSANKSRVKMRGKRRPQ
TRAARRLAAQESSEAEDMSVPRGPIAQWADGAISPNGHRPQLRAASGEDSTEEALAAAAA
PWEGGPVPGVDTSPFAKSLGHSRGEADLFDSGDIFSTGTGSQSVERTKPKAKIAENPANP
PVGGKAKSPMFPALGEASSDDDLFQSAKPKPAKKTNPFPLLEDEDDLFTDQKVKKNETKS
SSQQDVILTTQDIFEDDIFATEAIKPSQKTREKEKTLESNLFDDNIDIFADLTVKPKEKS
KKKVEAKSIFDDDMDDIFSTGIQAKTTKPKSRSAQAAPEPRFEHKVSNIFDDPLNAFGGQ
NT seq 3963 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaccggacgacccccgaccaggagctggtgccggcgtcggagcccgtgtgggag
cggccgtggtcggtggaggagatccgcaggagcagccagagctggtcgctggcggccgac
gcgggcctactacagtttctacaggaattctcacagcaaactatctctaggacccatgaa
atcaagaaacaagtggacggactaatccgggaaaccaaagccacagattgtcgcctgcat
aatgtcttcaatgacttccttatgctctctaatacccagttcatagagaatcgtgtatat
gatgaagaagtggaggagccagtactcaaggctgaggcagaaaaaacagagcaggagaag
acacgagagcagaaagaagtagatctcattcctaaagtccaggaggctgtgaactatggc
ttacaagtattggacagtgcctttgagcaacttgatatcaaagcaggaaactcagactcc
gaggaagatgatgctaatgggcgggtggaactgatccttgaaccaaaggatctatacatt
gatcgtcctttaccatatctcattgggtcaaagctgttcatggaacaagaagatgtaggt
cttggagagctgtccagtgaagaaggctctgtaggcagtgatcgtggcagtattgtggac
actgaggaagagaaagaagaggaggagtcagatgaagattttgcccatcacagtgacaat
gaacaaaaccagcacaccacacaaatgagtgatgaggaagaggatgatgatggctgtgac
ctttttgctgactctgagaaggaggaggaagatattgaggacattgaagaaaatactaga
cctaaaagaagcagacctacatcgtttgcagatgagctggctgcccgcatcaagggggat
gccatgggtcgagtggacgaggagccgacaaccttaccctcaggagaagcaaaacctcgg
aagacactcaaagagaagaaggaaaggagaactccttcagacgatgaagaggataactta
ttcgcaccccccaagctgaccgacgaggacttctcgccatttggctctggaggtggcctg
ttcagtggcggcaaggggctatttgatgatgaggacgaggagagtgacctcttcacggaa
gcctcccaggatcggcaagctggagcctctgttaaggaggagtcttcatcatccaaacct
ggaaagaaaatcccagcaggagctgtttctgtatttttaggagacacggatgtgtttggt
gctgcctccgttccatcactgaaggagccacagaagcctgagcagcccactccaaggaaa
agcccctatggtccccctcccactggcctctttgatgatgatgatggtgatgatgatgac
gactttttctcggcaccccacagcaaaccttctaaaacacgcaaagtccaatccactgcc
gatatctttggtgacgaagaaggagatctgttcaaagaaaaagccgtagcatcgccagaa
gccactgtgagtcagacagatgaaaataaagcaagagcagaaaaaaaggttaccttatct
tacagcaaaaatctcaagccctcatcagaaacaaagactcaaaaaggcttattttcagat
gaggaggactctgaggatttgttttcttctcaaagtgcgagtaacttaaaaggtgcatct
ctgctgcctggcaagctccccacgtcggtttccctgtttgatgatgaagatgaagaggat
aatctttttgggggtacagctgctaagaagcagacattgtctctacaagctcagagagaa
gagaaagcaaaagcctccgagctctccaaaaagaaagcatctgccctgttgttcagcagt
gatgaggaggaccagtggaatattcctgcttcacagacccacttagcatctgacagcagg
tctaaaggagaacccagggattctgggaccctccagagccaggaggccaaggctgtgaaa
aagaccagtctctttgaggaagacaaagaagatgatctttttgccattgccaaggacagc
caaaagaagacccagagagtgtcactcctctttgaagacgatgttgatagcggaggctct
ctgtttggctctcctcccacatctgttcctcctgcaacaaagaaaaaagagactgtctct
gaggcaccacctttgctgttcagcgatgaagaagagaaggaggcacaacttggagtgaag
tctgtggataagaaggttgagagtgccaaggagtcattaaaatttgggagaactgatgtg
gctgagtcagaaaaggaaggacttttgactagatctgctcaggaaacagtcaagcattct
gatttattttcttcatcatccccatgggacaaaggaaccaagcctagaaccaaaactgtt
cttagcttgtttgatgaggaagaggataaaatggaagatcaaaacattatccaggctcca
cagaaagaagtaggaaagggctgcgatcctgatgcccaccccaagagcacaggtgtcttc
caggatgaagagctgcttttcagccacaagctccaaaaggacaatgacccagatgttgac
ctttttgctggcaccaaaaaaaccaagctgttagagccaagtgttgggagcctgtttggg
gatgatgaagatgatgatcttttcagctctgccaagtcccagcctttggtacaagagaaa
aagagagtagtgaaaaaagaccactctgttaactctttcaaaaaccagaaacatcctgaa
tccattcaaggtagtaaagaaaaaggcatatggaagccggaaacacctcaggcaaattta
gcgatcaacccagcggccttgctgcccacagcggcttcccagatctctgaagtaaagcct
gttttgccagaattggcttttccttcatctgaacacagaaggagccacggtctggaaagt
gtgcctgtccttcccgggagtggggaggccggtgtgagttttgatcttccagctcaggca
gacaccttacacagtgcaaacaagagccgtgtcaagatgagagggaagcgtagaccgcag
acccgtgcagctaggcggctggctgctcaggagtccagcgaggctgaggacatgagcgtc
cccagaggacccattgcacagtgggctgatggcgccatttccccaaatggccatcggcca
cagctcagagcagccagtggagaagacagcactgaggaggccctggcagctgccgctgca
ccttgggaaggtggtcctgtgcctggagtggacacaagcccctttgcaaagtctctgggt
cattccagaggggaggctgacctttttgattctggggacattttttccacgggcactgga
tctcagtccgtggagagaacaaaacccaaggcaaagatagcagagaatcctgccaaccca
ccagtgggtggtaaagcaaagagccccatgtttcctgctctaggcgaggccagcagtgat
gatgatctctttcagtctgctaaaccaaaaccagcaaagaaaacaaatccctttcctctc
ctggaagatgaggatgacctctttacagatcagaaagtcaagaagaatgagacaaaatcc
agtagtcagcaggatgtcatattaacaacacaagatatttttgaggatgatatatttgct
acggaagcaattaaaccctctcagaaaaccagagagaaggagaaaacattggaatctaat
ttatttgatgataacattgatatctttgctgacttaactgtaaaaccaaaagaaaagtcc
aaaaagaaagtggaagccaagtctatatttgatgatgatatggatgacatcttctccact
ggtatccaggctaagacaaccaaaccaaaaagccgatctgcacaggccgcacctgaacca
agatttgaacacaaggtgtccaacatctttgatgatcccctgaatgcctttggaggccag
tag

DBGET integrated database retrieval system