KEGG   Homo sapiens (human): 253782
Entry
253782            CDS       T01001                                 

Gene name
CERS6, CERS5, LASS6
Definition
(RefSeq) ceramide synthase 6
  KO
K23727  sphingoid base N-palmitoyltransferase [EC:2.3.1.291]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    253782 (CERS6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    253782 (CERS6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.291  sphingoid base N-palmitoyltransferase
     253782 (CERS6)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain
Other DBs
NCBI-GeneID: 253782
NCBI-ProteinID: NP_982288
OMIM: 615336
HGNC: 23826
Ensembl: ENSG00000172292
Vega: OTTHUMG00000132183
Pharos: Q6ZMG9(Tbio)
UniProt: Q6ZMG9
Position
2q24.3
AA seq 384 aa
MAGILAWFWNERFWLPHNVTWADLKNTEEATFPQAEDLYLAFPLAFCIFMVRLIFERFVA
KPCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQR
RNQEKPSTLTRFCESMWRFSFYLYVFTYGVRFLKKTPWLWNTRHCWYNYPYQPLTTDLHY
YYILELSFYWSLMFSQFTDIKRKDFGIMFLHHLVSIFLITFSYVNNMARVGTLVLCLHDS
ADALLEAAKMANYAKFQKMCDLLFVMFAVVFITTRLGIFPLWVLNTTLFESWEIVGPYPS
WWVFNLLLLLVQGLNCFWSYLIVKIACKAVSRGKVSKDDRSDIESSSDEEDSEPPGKNPH
TATTTNGTSGTNGYLLTGSCSMDD
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggcagggatcttagcctggttctggaacgagaggttttggctcccgcacaatgtcacc
tgggcggacctgaagaacacggaggaggccaccttcccgcaggctgaggacctctatctc
gcttttcccctggccttctgtatcttcatggtgcggctcatcttcgagagatttgtagcc
aaaccgtgcgccatagccctcaacattcaggccaatggaccacaaattgctccgcccaat
gccattctggaaaaggtcttcactgcaattacaaagcatcctgatgaaaagagattggaa
ggcctctccaagcaactggactgggatgttcgaagcattcagcgctggtttcgacaaaga
cgcaatcaggagaagccaagcacgctgacgaggttctgtgagagcatgtggagattttca
ttttacctttatgtatttacctacggagtcagattcctgaaaaagaccccctggttgtgg
aatacgaggcattgctggtacaactacccctatcagccactcacaactgaccttcactac
tattacatcctggagctgtcgttttattggtctttgatgttttctcagttcactgatatc
aaaagaaaggactttggcattatgttcctgcaccaccttgtatctattttcttgattacc
ttttcatatgtcaacaatatggcccgagtaggaacgctggtcctttgtcttcatgattca
gctgatgctcttctggaggctgccaaaatggcaaattatgccaagtttcagaaaatgtgt
gatctcctgtttgttatgtttgccgtggtttttatcaccacacgactgggtatatttcct
ctctgggtgttaaataccacattatttgaaagctgggagatcgttggaccttacccttcc
tggtgggtttttaacctactgctattgctagtacaagggttgaactgcttctggtcttac
ttgattgtgaaaatagcttgcaaagctgtttcaagaggcaaggtgtccaaggatgatcga
agtgatattgagtctagctcagatgaggaggactcagaacctccgggaaagaatccccac
actgcgacaaccaccaatgggaccagtggtaccaacgggtatctcctgactggctcctgc
tccatggatgattaa

KEGG   Homo sapiens (human): 91012
Entry
91012             CDS       T01001                                 

Gene name
CERS5, LASS5, Trh4
Definition
(RefSeq) ceramide synthase 5
  KO
K23727  sphingoid base N-palmitoyltransferase [EC:2.3.1.291]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    91012 (CERS5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    91012 (CERS5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.291  sphingoid base N-palmitoyltransferase
     91012 (CERS5)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain
Other DBs
NCBI-GeneID: 91012
NCBI-ProteinID: NP_671723
OMIM: 615335
HGNC: 23749
Ensembl: ENSG00000139624
Vega: OTTHUMG00000169819
Pharos: Q8N5B7(Tbio)
UniProt: Q8N5B7
Position
12q13.12
AA seq 392 aa
MATAAQGPLSLLWGWLWSERFWLPENVSWADLEGPADGYGYPRGRHILSVFPLAAGIFFV
RLLFERFIAKPCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVR
KIQCWFRHRRNQDKPPTLTKFCESMWRFTFYLCIFCYGIRFLWSSPWFWDIRQCWHNYPF
QPLSSGLYHYYIMELAFYWSLMFSQFTDIKRKDFLIMFVHHLVTIGLISFSYINNMVRVG
TLIMCLHDVSDFLLEAAKLANYAKYQRLCDTLFVIFSAVFMVTRLGIYPFWILNTTLFES
WEIIGPYASWWLLNGLLLTLQLLHVIWSYLIARIALKALIRGKVSKDDRSDVESSSEEED
VTTCTKSPCDSSSSNGANRVNGHMGGSYWAEE
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcgacagcagcgcagggacccctaagcttgctgtggggctggctgtggagcgagcgc
ttctggctacccgagaacgtgagctgggctgatctggaggggccggccgacggctacggt
tacccccgcggccggcacatcctctcggtgttcccgctggcggcgggcatcttcttcgtg
aggctgctcttcgagcgatttattgccaaaccctgtgcactctgtattggcatcgaggac
agtggtccttatcaggcccaacccaatgccatccttgaaaaggtgttcatatctattacc
aagtatcctgataagaaaaggctggagggcctgtcaaagcagctggattggaatgtccga
aaaatccaatgctggtttcgccatcggaggaatcaggacaagcccccaacgcttactaaa
ttctgtgaaagcatgtggagattcacattttatttatgtatattctgctatggaattaga
tttctctggtcgtcaccttggttctgggacatccgacagtgctggcataactatccattt
cagcctctttcaagtgggctttatcactattatatcatggaattggccttctattggtcc
cttatgttttctcagtttacagacattaaaagaaaggacttcctgatcatgtttgtgcat
cacttggtcaccattgggcttatctccttctcctacatcaacaatatggttcgagtggga
actctgatcatgtgtctacatgatgtctcagacttcttgctggaggcagccaaactggcc
aattatgccaagtatcagcggctctgtgacaccctttttgtgatcttcagtgctgttttt
atggttacacgactaggaatctatccattctggattctgaacacgaccctctttgagagt
tgggagataatcgggccttatgcttcatggtggctcctcaatggcctgctgctgacccta
cagcttctgcatgtcatctggtcctacctaattgcacggattgctttgaaagccttgatc
aggggaaaggtatcgaaggatgatcgcagtgatgtggagagcagctcagaggaagaagat
gtgaccacctgcacaaaaagtccctgtgacagtagctccagcaatggtgccaatcgggtg
aatggtcacatgggaggcagctactgggctgaagagtaa

DBGET integrated database retrieval system