KEGG   Homo sapiens (human): 253935Help
Entry
253935            CDS       T01001                                 

Gene name
ANGPTL5
Definition
(RefSeq) angiopoietin like 5
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C
Motif
Other DBs
NCBI-GeneID: 253935
NCBI-ProteinID: NP_835228
OMIM: 607666
HGNC: 19705
Ensembl: ENSG00000187151
Vega: OTTHUMG00000167318
Pharos: Q86XS5(Tdark)
UniProt: Q86XS5
Position
11q22.1
AA seq 388 aa AA seqDB search
MMSPSQASLLFLNVCIFICGEAVQGNCVHHSTDSSVVNIVEDGSNAKDESKSNDTVCKED
CEESCDVKTKITREEKHFMCRNLQNSIVSYTRSTKKLLRNMMDEQQASLDYLSNQVNELM
NRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDTIGSVTKTPSGLYIIHPEGSSYPFE
VMCDMDYRGGGRTVIQKRIDGIIDFQRLWCDYLDGFGDLLGEFWLGLKKIFYIVNQKNTS
FMLYVALESEDDTLAYASYDNFWLEDETRFFKMHLGRYSGNAGDAFRGLKKEDNQNAMPF
STSDVDNDGCRPACLVNGQSVKSCSHLHNKTGWWFNECGLANLNGIHHFSGKLLATGIQW
GTWTKNNSPVKIKSVSMKIRRMYNPYFK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctccatcccaagcctcactcttattcttaaatgtatgtatttttatttgtgga
gaagctgtacaaggtaactgtgtacatcattctacggactcttcagtagttaacattgta
gaagatggatctaatgcaaaagatgaaagtaaaagtaatgatactgtttgtaaggaagac
tgtgaggaatcatgtgatgttaaaactaaaattacacgagaagaaaaacatttcatgtgt
agaaatttgcaaaattctattgtttcctacacaagaagtaccaaaaaactactaaggaat
atgatggatgagcaacaagcttccttggattatttatctaatcaggttaacgagctcatg
aatagagttctccttttgactacagaagtttttagaaaacagctggatccttttcctcac
agacctgttcagtcacatggtttagattgcactgatattaaggataccattggctctgtc
accaaaacaccgagtggtttatacataattcacccagaaggatctagctacccatttgag
gtaatgtgtgacatggattacagaggaggtggacggactgtgatacagaaaagaattgat
gggataattgatttccagaggttgtggtgtgattatctggatggatttggagatcttcta
ggagaattttggctaggactgaaaaagattttttatatagtaaatcagaaaaataccagt
tttatgctgtatgtggctttggaatctgaagatgacactcttgcttatgcatcatatgat
aatttttggctagaggatgaaacgagattttttaaaatgcacttaggacggtattcagga
aatgctggtgatgcattccggggtctcaaaaaagaagataatcaaaatgcaatgcctttt
agcacatcagatgttgataatgatgggtgtcgccctgcatgcctggtcaatggtcagtct
gtgaagagctgcagtcacctccataacaagaccggctggtggtttaacgagtgtggtcta
gcaaatctaaatggcattcatcacttctctggaaaattgcttgcaactggaattcaatgg
ggcacgtggaccaaaaacaactcacctgtcaagattaaatctgtttcaatgaaaattaga
agaatgtacaatccatattttaaataa

DBGET integrated database retrieval system