KEGG   Homo sapiens (human): 253982
Entry
253982            CDS       T01001                                 
Symbol
ASPHD1
Name
(RefSeq) aspartate beta-hydroxylase domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Asp_Arg_Hydrox
Other DBs
NCBI-GeneID: 253982
NCBI-ProteinID: NP_859069
HGNC: 27380
Ensembl: ENSG00000174939
Pharos: Q5U4P2(Tdark)
UniProt: Q5U4P2
Position
16:29900363..29919864
AA seq 390 aa
MKEGRGSFSVERGPRKERETAQSGMWKGNSPAGSQGAAMEGTGGELGGQGNWGPEDAPGL
LARASLIMLPWPLPLASSALTLLFGALTSLFLWYCYRLGSQDMQALGAGSRAGGVRGGPV
GCSEAGGPSPGGPGDPGEGPRTEGLVSRRLRAYARRYSWAGMGRVRRAAQGGPGPGRGPG
VLGIQRPGLLFLPDLPSAPFVPRDAQRHDVELLESSFPAILRDFGAVSWDFSGTTPPPRG
WSPPLAPGCYQLLLYQAGRCQPSNCRRCPGAYRALRGLRSFMSANTFGNAGFSVLLPGAR
LEGRCGPTNARVRCHLGLKIPPGCELVVGGEPQCWAEGHCLLVDDSFLHTVAHNGSPEDG
PRVVFIVDLWHPNVAGAERQALDFVFAPDP
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgaaggaggggagagggagcttcagcgtggagagaggaccgcggaaggagagagagaca
gcccagagtggaatgtggaagggaaacagtccagcggggagccagggggcagccatggaa
gggacaggtggggagctggggggacaggggaactggggtccggaggacgccccaggcctc
ttggccagggcctccctgatcatgctcccgtggccactacccctggcctcctcggccctc
accttgctcttcggggccctcacttccctgttcctctggtactgctaccgcctgggctcc
caagacatgcaggccctaggggctgggagccgagctgggggtgttcgtggtgggcctgtg
ggatgctcggaggccggcgggccaagcccagggggtcctggggatcccggggaaggacct
aggacggaaggcctagtgagccggcggcttcgggcctacgcaaggcgctactcctgggct
gggatgggtagagtgaggcgggcagctcagggtggcccaggccctgggagagggccaggg
gtcctaggtattcagcgcccaggcctgcttttcctaccagacctgccttcagcccccttt
gtgccgcgggacgcccagcggcacgacgtggagctcctggagagcagcttccctgccatt
ttgcgggacttcggggctgtgagctgggacttctcagggactacccctccgcctcggggc
tggtccccacctctggcccccgggtgctaccagctcctgctgtaccaagcaggccggtgc
caacccagcaactgccgccggtgcccgggggcctatcgggcactgagggggcttcgaagc
tttatgagtgccaacaccttcggcaatgccggcttttccgttctcctgcctggggcccgg
ctcgagggccgctgtgggcccaccaatgcccgggtcagatgccatctgggcctaaagatc
cctcctggctgtgagctggtggtcggcggtgagccccagtgctgggctgaggggcactgt
ctactggtggacgactcttttctacacacagtggctcacaatggctcccccgaagatggg
cctcgagtggtcttcatcgtggacctctggcaccccaacgtggcaggggctgagcgccag
gccctcgactttgtcttcgccccagacccttga

DBGET integrated database retrieval system