KEGG   Homo sapiens (human): 254013
Entry
254013            CDS       T01001                                 

Gene name
ETFBKMT, C12orf72, ETFB-KMT, METTL20
Definition
(RefSeq) electron transfer flavoprotein subunit beta lysine methyltransferase
  KO
K22843  ETFB lysine methyltransferase [EC:2.1.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    254013 (ETFBKMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     254013 (ETFBKMT)
SSDB
Motif
Pfam: PrmA Methyltransf_16 MTS Met_10 Methyltransf_25 PCMT Cons_hypoth95
Other DBs
NCBI-GeneID: 254013
NCBI-ProteinID: NP_001129335
OMIM: 615256
HGNC: 28739
Ensembl: ENSG00000139160
Vega: OTTHUMG00000169085
Pharos: Q8IXQ9(Tdark)
UniProt: Q8IXQ9
Position
12p11.21
AA seq 262 aa
MALSLGWKAHRNHCGLLLQALRSSGLLLFPCGQCPWRGAGSFLDPEIKAFLEENTEVTSS
GSLTPEIQLRLLTPRCKFWWERADLWPHSDPYWAIYWPGGQALSRYLLDNPDVVRGKSVL
DLGSGCGATAIAAKMSGASRILANDIDPIAGMAITLNCELNRLNPFPILIQNILNLEQDK
WDLVVLGDMFYDEDLADSLHQWLKKCFWTYRTRVLIGDPGRPQFSGHSIQHHLHKVVEYS
LLESTRQENSGLTTSTVWGFQP
NT seq 789 nt   +upstreamnt  +downstreamnt
atggctttgagtctaggttggaaagcacacaggaaccactgtggtctcctcttgcaggct
ctgcgaagcagtggtcttctcttgtttccctgtggccagtgtccctggagaggagctgga
agctttttggaccctgagataaaggctttcctggaggagaacactgaagtcaccagcagt
ggtagcctcacccctgaaatccagttgcggcttttgacccccagatgcaaattctggtgg
gagagagctgacctgtggccccacagtgatccttactgggcaatctactggccaggaggc
caagccctgtctaggtatcttttggataatcctgatgttgtcagaggaaaatctgtatta
gatcttgggagtggatgtggagctacagctattgctgctaagatgagtggggcatcaagg
atcttggccaatgacatagaccctattgcaggaatggctattacactaaattgtgaattg
aacagactgaatccttttcctattttaatccaaaacattttgaatttggaacaagataag
tgggaccttgttgttcttggcgatatgttttatgatgaagaccttgcagatagtcttcat
cagtggctgaagaagtgcttctggacctatagaactcgagtactgattggtgaccctggg
cggccccagttcagtggacacagcattcagcatcacctgcacaaagtggtagaatattca
cttttggagtctactaggcaggaaaacagtggactgacaacaagcacagtgtggggtttt
cagccttga

DBGET integrated database retrieval system