KEGG   Homo sapiens (human): 254122
Entry
254122            CDS       T01001                                 
Symbol
SNX32, SNX6B
Name
(RefSeq) sorting nexin 32
  KO
K17920  sorting nexin-5/6/32
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    254122 (SNX32)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    254122 (SNX32)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    254122 (SNX32)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Sorting nexins
    254122 (SNX32)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   254122 (SNX32)
SSDB
Motif
Pfam: Vps5 PX Latarcin
Other DBs
NCBI-GeneID: 254122
NCBI-ProteinID: NP_689973
HGNC: 26423
Ensembl: ENSG00000172803
Pharos: Q86XE0(Tdark)
UniProt: Q86XE0
Structure
Position
11:65833963..65853701
AA seq 403 aa
METYAEVGKEGKPSCASVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSV
VRQHEEFIWLHDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMK
QELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRKELLGG
FLRNIVKSADEALITGMSGLKEVDDFFEHERTFLLEYHTRIRDACLRADRVMRAHKCLAD
DYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDS
QAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELM
DFKSRRVSSFRKNLIELAELELKHAKASTLILRNTLVALKGEP
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggagacgtatgcggaggttgggaaggagggcaagccttcctgtgcatcggtggatctg
cagggagacagctccttacaggtggagatttctgacgcagtgagtgagcgggacaaggtg
aaattcactgttcaaacaaagagctgcctccctcacttcgcccagaccgagttctcagtc
gtgcggcagcacgaggagttcatctggctgcatgatgcctacgtggagaatgaggagtac
gccggcctcatcatccccccagcccctccgaggccagactttgaggcttcgagggaaaag
ctacagaaattgggcgagggggacagctctgtcactcgggaagagtttgccaagatgaag
caggagctggaagcggagtacctggccatctttaagaagacagttgcgatgcacgaagtc
tttctgcagcgcctggcggcccaccccaccctgcgtcgagaccacaacttctttgtgttt
ttggaatatggacaggatctgagtgtccgggggaagaacaggaaggagctcctcggaggg
tttctgaggaatattgtgaagtccgcggatgaagccctcatcacgggcatgtcagggctc
aaggaggtggatgacttctttgagcatgagaggaccttcctgttggagtatcacacccgt
atccgagatgcctgcctgcgggccgaccgcgtcatgcgcgcccacaagtgcctggcagac
gattatatccctatctcagctgcgctgagcagtctgggaacacaggaagtcaaccagcta
aggacgagcttcctcaaattggcagagctctttgaacggctgaggaagctggagggccgg
gtggcttccgatgaggacctgaagctgtcagacatgctgaggtactacatgcgtgactca
caggcagccaaggacctgctgtaccggcggctgcgggcactggccgactacgagaatgcc
aacaaggcgctggacaaggcgcgcaccaggaaccgggaggtgcggcccgccgagagccac
cagcagctgtgctgccaacgcttcgagcgcctctccgactccgccaagcaagagctcatg
gacttcaagtcccgccgggtctcctcttttcgaaagaatctcattgagctggcagagctg
gagctcaaacacgccaaggccagcaccctgattctccggaacacccttgttgccctaaag
ggggagccttag

DBGET integrated database retrieval system