KEGG   Homo sapiens (human): 254170
Entry
254170            CDS       T01001                                 
Symbol
FBXO33, BMND12, Fbx33, c14_5247
Name
(RefSeq) F-box protein 33
  KO
K10310  F-box protein 33
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    254170 (FBXO33)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     254170 (FBXO33)
SSDB
Motif
Pfam: F-box-like F-box
Other DBs
NCBI-GeneID: 254170
NCBI-ProteinID: NP_976046
OMIM: 609103
HGNC: 19833
Ensembl: ENSG00000165355
Pharos: Q7Z6M2(Tbio)
UniProt: Q7Z6M2
Position
14:complement(39397684..39432433)
AA seq 555 aa
MLLFLSVPQPRPPGARTRAGAARVARWRRLRLQQLRRLRGLLRVLRGRPGAGSRRRGRMA
LCGQAAGAASLPSELIVHIFSFLPAPDRLRASASCSHWRECLFYPALWPQLRICLRVSPA
EQPRLEFLMRKCGWFVRELRVEFAAENYLSGGGPGDGGGADTGTGGEEVEALQLSARWLE
VLRTYLELVLCVLVSIRNNRNLQKFSLFGDISVLQQQGSLSNTYLSKVDPDGKKIKQIQQ
LFEEILSNSRQLKWLSCGFMLEIVTPTSLSSLSNAVANTMEHLSLLDNNIPGNSTLITAV
ELERFVNLHSLALDFCDFTAEMARVLTDSNHVPLQRLSLLVHNVSVMHKSLDNMPNDEHW
KALSRKSTSFRVYIMAFDIKSEDMLKILKPSIPLERIHFDSYITCVSGAIVDLISRQYDK
FLTHFILMNDVIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL
RGSDLKVLEVTEESIDFDQGELADQDVDPVHNLIEQVSLGLGQPWHAVMDIESLSVFTEP
NRHFYREMQSFSEDI
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgttgttgttcttgtcagtgccgcagccccgaccgccgggagctcgaacccgagccggg
gccgcccgggtggcgcggtggcggcggctgcggctgcagcagctgcgacggctgcggggg
ctgctccgggtactgcgggggcggccgggagccggcagccggcggcggggccggatggct
ctgtgcgggcaggcggcgggcgctgcgtcgctgcccagcgagctgatcgtgcacatcttc
tcttttctgccggcgcccgaccggctgcgggcctcggcctcctgctcgcactggcgtgag
tgcctcttctatccggccctgtggccccagctccgcatctgcctccgcgtctcgcccgcg
gagcagcctcggctggaattcctcatgcgcaagtgcggctggttcgtgcgagagctgcgt
gttgaattcgccgccgagaactatctgagcggcggtggcccaggggacggaggtggcgcg
gacaccgggactggaggggaggaagtcgaggccctgcagctctcagctcgttggctggaa
gtgctgcgcacctacttggagctggtgctttgcgtgctggtcagcatccggaacaacagg
aaccttcagaagtttagtctttttggagacataagtgttctacaacagcaaggaagtttg
tcaaatacatacctcagcaaggtggaccctgatggcaaaaaaattaaacaaattcagcaa
ctgtttgaagaaatcctgagtaatagtaggcaactgaaatggctgtcctgtgggtttatg
ctggaaatagtaaccccaacatcactgtcatctctctctaatgctgttgccaacaccatg
gagcacctcagtttactggacaataatattcctggtaacagcactcttattactgcagtt
gaactggagcgatttgtgaatctgcactcacttgccttggatttttgtgactttacagct
gagatggcaagagtcttaactgatagcaaccatgtgcctttgcaacgactgtctcttctg
gttcacaatgtttctgtaatgcacaagtctctggacaacatgccaaatgatgagcattgg
aaagccctgtcacgaaagagcaccagctttcgggtctatataatggcttttgatatcaag
agtgaagatatgttaaagattctgaaacccagtataccactagagaggattcattttgat
agctatatcacttgtgtttcaggggctattgttgatcttatatccaggcaatatgacaag
ttcctcactcattttattttaatgaatgatgtgattgacacatctggttttccagatctt
agtgacaaccgaaatgaagatccgttggttttattagcatggaggtgcacaaagctctct
cttctggcaattcatggttacacggtgtgggcacacaacctcattgccattgctcgtctt
cggggctctgatctgaaagtgcttgaagtcaccgaagaaagcattgattttgaccaaggt
gaactggccgaccaggatgtagatccagtgcataaccttattgagcaggtatccctgggc
ctgggtcaaccttggcatgcagtcatggacatcgaatcactcagtgtcttcactgaacca
aatcgtcatttttacagagagatgcaaagcttcagtgaagacatttag

DBGET integrated database retrieval system