KEGG   Homo sapiens (human): 254228
Entry
254228            CDS       T01001                                 
Symbol
CALHM5, C6orf188, FAM26E, dJ493F7.3
Name
(RefSeq) calcium homeostasis modulator family member 5
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Ca_hom_mod Ac76
Other DBs
NCBI-GeneID: 254228
NCBI-ProteinID: NP_714922
HGNC: 21568
Ensembl: ENSG00000178033
Pharos: Q8N5C1(Tdark)
UniProt: Q8N5C1
Structure
Position
6:116511639..116524788
AA seq 309 aa
MDAFQGILKFFLNQKTVIGYSFMALLTVGSERLFSVVAFKCPCSTENMTYGLVFLFAPAW
VLLILGFFLNNRSWRLFTGCCVNPRKIFPRGHSCRFFYVLGQITLSSLVAPVMWLSVALL
NGTFYECAMSGTRSSGLLELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQAQSQ
ILGWCLICSASFFSLLTTCYARCRSKVSYLQLSFWKTYAQKEKEQLENTFLDYANKLSER
NLKCFFENKRPDPFPMPTFAAWEAASELHSFHQSQQHYSTLHRVVDNGLQLSPEDDETTM
VLVGTAHNM
NT seq 930 nt   +upstreamnt  +downstreamnt
atggatgcttttcagggcattttaaaattcttccttaatcagaaaactgttattggctac
agcttcatggctctgctgaccgtgggaagtgagcgtctcttttctgttgtggcttttaag
tgcccctgcagcactgagaatatgacctatgggctggttttcctctttgctcctgcctgg
gtgttactgatcctgggattctttctgaacaataggtcgtggagactcttcacaggctgc
tgtgtgaatcccaggaaaatctttcccagaggccacagctgccgtttcttctacgtcctc
ggccagatcactctgagctcattggtggctccagtgatgtggctttctgtggctctgctc
aatggaactttctatgaatgtgccatgagcgggacgagaagttcaggactcctggaactg
atttgcaagggtaagcccaaagagtgctgggaagaacttcacaaagtatcttgtggcaaa
actagcatgctacctaccgtcaatgaagaactgaaactctcccttcaggcccagtctcag
attctaggatggtgcctgatttgttcagcgtctttcttctctctgctcaccacatgttat
gctcgctgccgatctaaagttagctaccttcagctgagtttttggaagacatatgcacaa
aaggagaaggagcagttggaaaatacatttctggactatgccaacaagctgagcgagagg
aacctgaaatgtttttttgaaaacaagaggccagatccttttcccatgcctacgtttgct
gcctgggaggctgcttcagagctgcattctttccaccaaagccagcaacactatagcacc
ctccacagagtggtggacaatggtctgcaacttagccctgaggatgatgagacgacaatg
gtccttgtgggtactgcccacaatatgtag

DBGET integrated database retrieval system