KEGG   Homo sapiens (human): 254263
Entry
254263            CDS       T01001                                 
Symbol
CNIH2, CNIH-2, Cnil
Name
(RefSeq) cornichon family AMPA receptor auxiliary protein 2
  KO
K20368  protein cornichon
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    254263 (CNIH2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    254263 (CNIH2)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    254263 (CNIH2)
Transporters [BR:hsa02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   254263 (CNIH2)
SSDB
Motif
Pfam: Cornichon
Other DBs
NCBI-GeneID: 254263
NCBI-ProteinID: NP_872359
OMIM: 611288
HGNC: 28744
Ensembl: ENSG00000174871
Pharos: Q6PI25(Tbio)
UniProt: Q6PI25
Position
11:66278175..66284206
AA seq 160 aa
MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERI
CCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAV
SIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSF
NT seq 483 nt   +upstreamnt  +downstreamnt
atggcgttcaccttcgccgcgttctgctacatgctcaccctggtgctgtgcgcctccctc
atcttctttgtcatctggcacatcatagcctttgatgagctgcggaccgacttcaagaac
cccatcgaccaggggaaccctgcgcgggcacgcgagcgtttaaaaaacatcgaacgcatc
tgctgcctcctgaggaagctggtggtcccagaatactccatccacggcctcttctgtctg
atgtttctgtgtgcagcagagtgggtgaccctgggcctcaacatccccctcctcttctac
cacctctggaggtacttccaccgtcctgcagatggctctgaggtcatgtatgatgcggtc
tccatcatgaatgctgacattctcaactactgccagaaggagtcctggtgcaaacttgcc
ttctacctgctctccttcttctattacctgtacagtatggtttatacgttggtgagtttc
taa

DBGET integrated database retrieval system