KEGG   Homo sapiens (human): 254394Help
Entry
254394            CDS       T01001                                 

Gene name
MCM9, C6orf61, MCMDC1, ODG4, dJ329L24.1, dJ329L24.3
Definition
(RefSeq) minichromosome maintenance 9 homologous recombination repair factor
  KO
K10738  DNA helicase MCM9 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Disease
H00599  46,XX gonadal dysgenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    254394 (MCM9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     254394 (MCM9)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   Other initiation factors
    254394 (MCM9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM_lid Mg_chelatase AAA_5 AAA_3 AAA_16 AAA
Motif
Other DBs
NCBI-GeneID: 254394
NCBI-ProteinID: NP_060166
OMIM: 610098
HGNC: 21484
Ensembl: ENSG00000111877
Vega: OTTHUMG00000015468
Pharos: Q9NXL9(Tbio)
UniProt: Q9NXL9
Position
6q22.31
AA seq 1143 aa AA seqDB search
MNSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETNMEIGEYFNM
FPSEVLTIFDSALRRSALTILQSLSQPEAVSMKQNLHARISGLPVCPELVREHIPKTKDV
GHFLSVTGTVIRTSLVKVLEFERDYMCNKCKHVFVIKADFEQYYTFCRPSSCPSLESCDS
SKFTCLSGLSSSPTRCRDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSGDDLTI
YGIVMQRWKPFQQDVRCEVEIVLKANYIQVNNEQSSGIIMDEEVQKEFEDFWEYYKSDPF
AGRNVILASLCPQVFGMYLVKLAVAMVLAGGIQRTDATGTRVRGESHLLLVGDPGTGKSQ
FLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSLK
EHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPQESVSVNIALGSPLL
SRFDLILVLLDTKNEDWDRIISSFILENKGYPSKSEKLWSMEKMKTYFCLIRNLQPTLSD
VGNQVLLRYYQMQRQSDCRNAARTTIRLLESLIRLAEAHARLMFRDTVTLEDAITVVSVM
ESSMQGGALLGGVNALHTSFPENPGEQYQRQCELILEKLELQSLLSEELRRLERLQNQSV
HQSQPRVLEVETTPGSLRNGPGEESNFRTSSQQEINYSTHIFSPGGSPEGSPVLDPPPHL
EPNRSTSRKHSAQHKNNRDDSLDWFDFMATHQSEPKNTVVVSPHPKTSGENMASKISNST
SQGKEKSEPGQRSKVDIGLLPSPGETGVPWRADNVESNKKKRLALDSEAAVSADKPDSVL
THHVPRNLQKLCKERAQKLCRNSTRVPAQCTVPSHPQSTPVHSPDRMLDSPKRKRPKSLA
QVEEPAIENVKPPGSPVAKLAKFTFKQKSKLIHSFEDHSHVSPGATKIAVHSPKISQRRT
RRDAALPVKRPGKLTSTPGNQISSQPQGETKEVSQQPPEKHGPREKVMCAPEKRIIQPEL
ELGNETGCAHLTCEGDKKEEVSGSNKSGKVHACTLARLANFCFTPPSESKSKSPPPERKN
RGERGPSSPPTTTAPMRVSKRKSFQLRGSTEKLIVSKESLFTLPELGDEAFDCDWDEEMR
KKS
NT seq 3432 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcgatcaagttacactggttggtcaagtgtttgagtcatatgtttcggaatac
cataagaatgatattcttctaatcttgaaggaaagggatgaagatgctcattacccagtt
gtggttaatgccatgactctgtttgagaccaacatggaaatcggggaatatttcaacatg
ttccccagtgaagtgcttacaatttttgatagtgcactgcgaaggtcagccttgacaatt
ctccagtccctttctcagcctgaggctgtttccatgaaacagaatcttcatgccaggata
tcaggtttgcctgtctgtcctgagctggtgagggaacacatacctaaaaccaaggatgtg
ggacactttttatctgtcactgggacagtgattcgaacaagtctggtgaaggttctggag
tttgagcgggattacatgtgtaacaaatgcaagcatgtgtttgtgatcaaggctgacttt
gagcagtattacaccttttgccggccatcctcgtgtcccagcttggagagctgtgattcc
tctaaattcacttgcctctcaggcttgtcttcgtctccaaccaggtgtagagattaccag
gaaatcaaaattcaggaacaggttcaaaggctatctgttggaagtattccacgatctatg
aaggttattctggaagatgacttagtggatagttgcaaatctggtgatgacctcactatt
tacgggattgtaatgcaacggtggaagccctttcagcaagatgtgcgctgtgaagtggag
atagtcctgaaagcaaattacatccaagtaaataatgagcagtcctcagggatcatcatg
gatgaggaggtccaaaaggaattcgaagatttttgggaatactataagagcgatcccttt
gcaggaaggaatgtaatattggctagcttgtgccctcaagtgtttggaatgtatctagta
aagcttgctgtggccatggtgctggctggtgggattcaaaggactgatgctacaggaaca
cgggtcagaggagaatctcatcttttattggttggggatcctggcacagggaaatctcag
ttcctcaaatatgcagcaaagattacaccaagatctgtgctgaccacaggaattggatct
actagtgcaggtctgacggtaactgctgtaaaagactcaggagaatggaatttggaggct
ggggcattagttcttgcagatgcgggcctttgctgtattgatgagttcaatagcctcaaa
gagcatgataggaccagtatccatgaagcaatggagcaacaaaccataagtgttgctaag
gctggcctcgtgtgcaagctgaacacaaggaccaccatcctggcagcaacgaaccccaaa
ggccagtacgacccccaggagtccgtgtctgtgaacattgccctcggcagcccactctta
agtcgatttgacctgatcctggttttgcttgataccaagaatgaagactgggatcgtatc
atttcctcctttatcttagaaaataaaggttacccaagcaaatcagagaagctctggagc
atggaaaagatgaaaacctatttctgcctcataaggaatctgcagcccacactgtctgat
gtgggcaatcaggttcttctccggtactaccagatgcaaaggcagagtgattgccggaac
gctgcccggaccaccattcggctgttggaaagcttgatacgattagcagaagctcatgct
cgcctgatgtttcgtgatactgtaactctggaagacgctattacggtggtgtcagtcatg
gagtcctcaatgcagggaggtgcactgctaggaggtgtgaatgccctccacacttccttt
cctgaaaaccctggagagcagtaccagagacagtgtgaacttattctggaaaagctagag
ctgcagagcctcttgagtgaagagcttagaagacttgaaaggttacagaatcagagtgtg
caccaatcccaaccacgggtattggaggtagagactactccaggatccttgagaaatggt
ccaggggaagaatcaaacttcagaacttcatcacagcaggaaatcaactatagcacacat
atcttctctcctggaggcagccccgagggaagcccagttctagatcccccaccgcatctg
gagcctaatagatcaacaagtaggaaacattcagctcagcacaaaaataacagagatgac
agtttagattggtttgatttcatggcaactcatcagagtgaacctaaaaacactgttgtt
gtgtctcctcatcccaaaacatctggagaaaatatggcttcgaagatctctaacagcaca
tctcagggtaaggagaagagtgagccaggccaaaggagcaaagtggacattgggttgctt
ccatcaccaggagagacaggtgttccatggagggcagacaatgtggaaagtaacaagaaa
aaaaggctagcactagattctgaagcagcagtctctgctgataaaccagactcagtactg
actcatcatgtccccaggaacctgcagaagctgtgcaaagagagggcccagaagttgtgc
agaaatagcaccagggtgcctgcacagtgcacagtcccttcccatcctcagtccactcct
gtacatagcccagacagaatgctggactcacccaaaagaaagagaccgaaatcccttgcg
caagtggaagagcctgcaattgaaaatgttaagcctccaggttcccctgtggccaaactg
gcaaaatttactttcaagcagaagtcaaaactgatccactcctttgaagatcacagccat
gtgtcacctggtgcaactaaaatagcagttcatagtcctaaaatttcccagcgtagaaca
agaagagacgcagccttgccggtgaagcgtccaggaaagttaacatctaccccaggaaac
cagatctccagtcagccacagggtgagacaaaggaggtgtcgcagcagccaccagagaaa
cacggaccaagagagaaggtgatgtgtgcccctgagaagaggattattcagcctgaatta
gagcttgggaacgagactgggtgtgctcatcttacttgtgagggagacaaaaaggaagag
gtttcaggcagtaataaaagcggcaaggttcatgcctgcacattagccagattggcaaac
ttctgctttactcccccatcggaatccaaatcaaaatcccctcctcctgaaaggaagaac
cgaggtgagagaggcccaagctcccctcctacaaccacagctccaatgcgtgtcagtaaa
aggaaatcttttcagctccgtgggtccaccgagaaactgattgtttccaaagaatccctc
ttcactttaccagaactaggtgatgaagcatttgattgtgactgggatgaagagatgaga
aaaaagtcatag

DBGET integrated database retrieval system