KEGG   Homo sapiens (human): 254427
Entry
254427            CDS       T01001                                 

Gene name
PROSER2, C10orf47
Definition
(RefSeq) proline and serine rich 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SARG
Other DBs
NCBI-GeneID: 254427
NCBI-ProteinID: NP_694988
HGNC: 23728
Ensembl: ENSG00000148426
Vega: OTTHUMG00000017673
Pharos: Q86WR7(Tdark)
UniProt: Q86WR7
Position
10p14
AA seq 435 aa
MPVTHRKSDASDMNSDTSPSCRLRAFSRGGSLESRSSSSRSRSFTLDDESLKYLTHEEKD
VLLFFEETIDSLDEDFEEPVLCDGGVCCLCSPSLEESTSSPSEPEDVIDLVQPAPGAGEA
EGLPEGTQAAGPAPAGKEHRKQDAETPPPPDPPAPETLLAPPPLPSTPDPPRRELRAPSP
PVEHPRLLRSVPTPLVMAQKISERMAGNEALSPTSPFREGRPGEWRTPAARGPRSGDPGP
GPSHPAQPKAPRFPSNIIVTNGAAREPRRTLSRAAVSVQERRAQVLATIHGHAGAFPAAG
DAGEGAPGGGSSPERVARGRGLPGPAESLRAGGQAPRGPALANGFPSAHEALKSAPSSFA
PAGKSLCFRPGPALPSTRARQSFPGPRQPNGAQDWRRADSLPRPQGITVQFAGRGSSEEA
RREALRKLGLLRESS
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgcctgtaacccaccggaaatcagacgcatctgacatgaactcagacacgtcccccagc
tgcaggctccgagccttcagcagaggcggcagcctggagagtcgaagcagcagctctcgc
tccagaagcttcactttggatgatgagagcctgaagtacctcacccatgaggaaaaggat
gtgctcctgttttttgaagagacgattgactccctagacgaggactttgaggagccagtg
ctgtgcgatggaggagtgtgctgcctctgctccccgtctctggaggagagcacctccagt
ccctccgagcctgaagatgtcatcgacttagtgcagccagcacctggcgccggggaagcc
gagggccttccagaggggacccaggcagcagggcctgcacctgctgggaaggagcacagg
aaacaagatgctgagactcctccacctccagaccccccggctcccgagacccttcttgcg
ccaccacccctgcctagcacccccgatccccccaggagggagctgcgcgccccctccccg
ccggtggagcaccccagactcctgcgctctgttcccacgcccctcgttatggcgcagaag
atttccgagaggatggcggggaacgaagccctctcgcccacctccccgttcagggagggc
cggcccggggagtggaggacacctgccgcccgggggccccgcagtggagaccctggcccg
gggcccagccacccggcgcagcccaaggcaccccgcttccccagcaacatcatcgtcacc
aacggcgcggcccgggagccccgcaggaccctgtccagggcggccgtcagcgtgcaggag
cgcagggcgcaggtgttggccaccatccacggccacgccggcgccttccccgccgcgggg
gacgccggcgagggggccccagggggcggctcctccccggagcgggtggcgcgtggccgg
ggcctgccgggccccgctgagagtctccgggcagggggtcaggctccgcggggcccggcg
ctggccaacggcttcccaagtgcgcacgaggccctgaagagcgcacccagctccttcgcg
cccgctgggaagtccctctgcttccgccctggcccggccctgcccagcacgcgggcccgt
cagagcttccccgggccccggcagcccaacggcgcccaggactggcgccgcgcagactcc
ctgccccggccccagggcatcaccgtgcagttcgcgggccgcggctcctcggaggaggcg
cgcagggaggccctgcggaagctggggctgctcagggagagttcgtga

DBGET integrated database retrieval system