KEGG   Homo sapiens (human): 254428
Entry
254428            CDS       T01001                                 

Gene name
SLC41A1, MgtE
Definition
(RefSeq) solute carrier family 41 member 1
  KO
K15122  solute carrier family 41
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    254428 (SLC41A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC41: MgtE-like magnesium transporter
   254428 (SLC41A1)
SSDB
Motif
Pfam: MgtE
Other DBs
NCBI-GeneID: 254428
NCBI-ProteinID: NP_776253
OMIM: 610801
HGNC: 19429
Ensembl: ENSG00000133065
Vega: OTTHUMG00000036000
Pharos: Q8IVJ1(Tbio)
UniProt: Q8IVJ1 B2RMP2
Position
1q32.1
AA seq 513 aa
MSSKPEPKDVHQLNGTGPSASPCSSDGPGREPLAGTSEFLGPDGAGVEVVIESRANAKGV
REEDALLENGSQSNESDDVSTDRGPAPPSPLKETSFSIGLQVLFPFLLAGFGTVAAGMVL
DIVQHWEVFQKVTEVFILVPALLGLKGNLEMTLASRLSTAANIGHMDTPKELWRMITGNM
ALIQVQATVVGFLASIAAVVFGWIPDGHFSIPHAFLLCASSVATAFIASLVLGMIMIGVI
IGSRKIGINPDNVATPIAASLGDLITLALLSGISWGLYLELNHWRYIYPLVCAFFVALLP
VWVVLARRSPATREVLYSGWEPVIIAMAISSVGGLILDKTVSDPNFAGMAVFTPVINGVG
GNLVAVQASRISTFLHMNGMPGENSEQAPRRCPSPCTTFFSPDVNSRSARVLFLLVVPGH
LVFLYTISCMQGGHTTLTLIFIIFYMTAALLQVLILLYIADWMVHWMWGRGLDPDNFSIP
YLTALGDLLGTGLLALSFHVLWLIGDRDTDVGD
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgtcctctaagccagagccgaaggacgtccaccaactgaacgggactggcccttctgcc
tctccctgctcttcagatggcccagggagagagcccttggctgggacctcagagttcctg
gggcctgatggggctggggtagaggtggtgattgagtctcgggccaacgccaagggggtt
cgggaggaggacgccctgctggagaacgggagccagagcaacgaaagtgacgacgtcagc
acagaccgtggccctgcgccaccttccccgctcaaggagacctccttttccatcgggctg
caagtactgtttccattcctcctggcaggctttgggaccgtggctgctggcatggtgttg
gacatcgtgcagcactgggaagtcttccagaaggtgacagaggtcttcatcctagtgcct
gcgctgctggggctcaaagggaacctggaaatgaccctggcatcaaggctttccactgca
gccaacattggacacatggacacacccaaggagctctggcggatgatcactgggaacatg
gccctcatccaggtgcaggccacggtggtgggcttcctggcgtccatcgcagccgtcgtc
tttggctggatccctgatggccacttcagtattccgcacgccttcctgctctgtgctagc
agcgtggccacagccttcattgcctccctggtactgggtatgatcatgattggagtcatc
attggctctcgcaagattgggatcaacccagacaacgtggccacacccattgctgccagc
ctgggcgacctcatcaccttggcgctgctctcaggcatcagctggggactctacctggaa
ctgaatcactggcgatacatctacccactggtgtgtgctttctttgtggccctgctgcct
gtctgggtggtgctggcccgacgaagtccagccacaagggaggtgttgtactcgggctgg
gagcctgttatcattgccatggccatcagcagtgtgggaggcctcatcttggacaagact
gtctcagaccccaactttgctgggatggctgtcttcacgcctgtgattaatggtgttggg
ggcaatctggtggcagtgcaggccagccgcatctccaccttcctgcacatgaatggaatg
cccggagagaactctgagcaagctcctcgccgctgtcccagtccttgtaccaccttcttc
agccctgatgtgaattctcgctcagcccgggtcctcttcctcctcgtggtcccaggacac
ctggtgttcctctacaccatcagctgtatgcagggcgggcacaccaccctcacactcatc
ttcatcatcttctatatgacagctgcactgctccaggtgctgattctcctgtacatcgca
gactggatggtgcactggatgtggggccggggcctggacccggacaacttctccatccca
tacttgactgctctgggggacctgcttggcactgggctcctagcactcagcttccatgtt
ctctggctcataggggaccgagacacggatgtcggggactag

DBGET integrated database retrieval system