KEGG   Homo sapiens (human): 254531
Entry
254531            CDS       T01001                                 

Gene name
LPCAT4, AGPAT7, AYTL3, LPAAT-eta, LPEAT2
Definition
(RefSeq) lysophosphatidylcholine acyltransferase 4
  KO
K13512  lysophospholipid acyltransferase [EC:2.3.1.23 2.3.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    254531 (LPCAT4)
   00565 Ether lipid metabolism
    254531 (LPCAT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    254531 (LPCAT4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     254531 (LPCAT4)
    2.3.1.-  
     254531 (LPCAT4)
Lipid biosynthesis proteins [BR:hsa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   254531 (LPCAT4)
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-GeneID: 254531
NCBI-ProteinID: NP_705841
OMIM: 612039
HGNC: 30059
Ensembl: ENSG00000176454
Vega: OTTHUMG00000172349
Pharos: Q643R3(Tdark)
UniProt: Q643R3
Position
15q14
AA seq 524 aa
MSQGSPGDWAPLDPTPGPPASPNPFVHELHLSRLQRVKFCLLGALLAPIRVLLAFIVLFL
LWPFAWLQVAGLSEEQLQEPITGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRGQRASRLQ
APVLVAAPHSTFFDPIVLLPCDLPKVVSRAENLSVPVIGALLRFNQAILVSRHDPASRRR
VVEEVRRRATSGGKWPQVLFFPEGTCSNKKALLKFKPGAFIAGVPVQPVLIRYPNSLDTT
SWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYHPSPEESRDPTLYANNVQRVMAQALGIP
ATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSAGYVDAGAEPGRSRMISQEEF
ARQLQLSDPQTVAGAFGYFQQDTKGLVDFRDVALALAALDGGRSLEELTRLAFELFAEEQ
AEGPNRLLYKDGFSTILHLLLGSPHPAATALHAELCQAGSSQGLSLCQFQNFSLHDPLYG
KLFSTYLRPPHTSRGTSQTPNASSPGNPTALANGTVQAPKQKGD
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgagccagggaagtccgggggactgggcccccctagatcccacccccggacccccagca
tcccccaaccccttcgtgcatgagttacatctctctcgcctccagagggttaagttctgc
ctcctgggggcattgctggcccccatccgagtgcttctggcctttatcgtcctctttctc
ctctggccctttgcctggcttcaagtggccggtcttagtgaggagcagcttcaggagcca
attacaggatggaggaagactgtgtgccacaacggggtgctaggcctgagccgcctgctg
tttttcctgctgggcttcctccggattcgcgttcgtggccagcgagcctctcgccttcaa
gcccctgtccttgttgctgccccacactccactttctttgaccccattgttctgctgccc
tgtgacctgcccaaagttgtgtcccgagctgagaacctttccgttcctgtcattggagcc
cttcttcgattcaaccaagccatcctggtatcccggcatgacccggcttctcgacgcaga
gtggtggaggaggtccgaaggcgggccacctcaggaggcaagtggccgcaggtgctattc
tttcctgagggcacctgttccaacaagaaggctttgcttaagttcaaaccaggagccttc
atcgcaggggtgcctgtgcagcctgtcctcatccgctaccccaacagtctggacaccacc
agctgggcatggaggggtcctggagtactcaaagtcctctggctcacagcctctcagccc
tgcagcattgtggatgtggagttccttcctgtgtatcaccccagccctgaggagagcagg
gaccccaccctctatgccaacaatgttcagagggtcatggcacaggctctgggcattcca
gccaccgaatgtgagtttgtagggagcttacctgtgattgtggtgggccggctgaaggtg
gcgttggaaccacagctctgggaactgggaaaagtgcttcggaaggctgggctgtccgct
ggctatgtggacgctggggcagagccaggccggagtcgaatgatcagccaggaagagttt
gccaggcagctacagctctctgatcctcagacggtggctggtgcctttggctacttccag
caggataccaagggtttggtggacttccgagatgtggcccttgcactagcagctctggat
gggggcaggagcctggaagagctaactcgtctggcctttgagctctttgctgaagagcaa
gcagagggtcccaaccgcctgctgtacaaagacggcttcagcaccatcctgcacctgctg
ctgggttcaccccaccctgctgccacagctttgcatgctgagctgtgccaggcaggatcc
agccaaggcctctccctctgtcagttccagaacttctccctccatgacccactctatggg
aaactcttcagcacctacctgcgccccccacacacctctcgaggcacctcccagacacca
aatgcctcatccccaggcaaccccactgctctggccaatgggactgtgcaagcacccaag
cagaagggagactga

DBGET integrated database retrieval system